Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7TXLOX)

• DOT Name: Stress-induced-phosphoprotein 1 (STIP1)
• Synonyms: STI1; Hsc70/Hsp90-organizing protein; Hop; Renal carcinoma antigen NY-REN-11; Transformation-sensitive protein IEF SSP 3521
• Gene Name: STIP1
• Related Disease:
  Neoplasm
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Amyloidosis
  Atrial fibrillation
  Breast neoplasm
  Cardiovascular disease
  Choriocarcinoma
  Colorectal carcinoma
  Cutaneous melanoma
  Cystic fibrosis
  Depression
  Endometrial cancer
  Endometrial carcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Major depressive disorder
  Melanoma
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Prostate carcinoma
  Squamous cell carcinoma
  Benign neoplasm
  Bladder cancer
  Clear cell renal carcinoma
  Gastric cancer
  Pancreatic cancer
  Renal cell carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Endometriosis
  Glioma
  Asthma
  Glaucoma/ocular hypertension
  Hereditary hemochromatosis
  Metastatic malignant neoplasm
  OPTN-related open angle glaucoma
  Stroke
• UniProt ID: STIP1_HUMAN
• PDB ID: 1ELR; 1ELW; 2LNI; 2NC9; 3ESK; 3FWV; 7KW7
• Pfam ID: PF17830 ; PF13414 ; PF13424 ; PF07719 ; PF13181
• Sequence:
  MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
  GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
  ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
  VLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
  FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
  KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
  LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
  IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
  SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
  AIR
• Function: Acts as a co-chaperone for HSP90AA1. Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90.
• KEGG Pathway: Prion disease (hsa05020)
• Reactome Pathway:
  RND1 GTPase cycle (R-HSA-9696273)
  HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand (R-HSA-3371497)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Amyloidosis	DISHTAI2	Strong	Biomarker	[4]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[6]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[7]
Choriocarcinoma	DISDBVNL	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Cutaneous melanoma	DIS3MMH9	Strong	Altered Expression	[1]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[10]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[12]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[14]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[17]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[18]
Melanoma	DIS1RRCY	Strong	Altered Expression	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[19]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[13]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Genetic Variation	[21]
Benign neoplasm	DISDUXAD	moderate	Altered Expression	[22]
Bladder cancer	DISUHNM0	moderate	Altered Expression	[23]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[24]
Gastric cancer	DISXGOUK	moderate	Biomarker	[25]
Pancreatic cancer	DISJC981	moderate	Biomarker	[26]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[24]
Stomach cancer	DISKIJSX	moderate	Biomarker	[25]
Urinary bladder cancer	DISDV4T7	moderate	Altered Expression	[23]
Urinary bladder neoplasm	DIS7HACE	moderate	Altered Expression	[23]
Endometriosis	DISX1AG8	Disputed	Genetic Variation	[12]
Glioma	DIS5RPEH	Disputed	Biomarker	[27]
Asthma	DISW9QNS	Limited	Genetic Variation	[28]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Biomarker	[29]
Hereditary hemochromatosis	DISVG5MT	Limited	Biomarker	[30]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[25]
OPTN-related open angle glaucoma	DISDR98A	Limited	Genetic Variation	[29]
Stroke	DISX6UHX	Limited	Altered Expression	[31]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Stress-induced-phosphoprotein 1 (STIP1) decreases the response to substance of Doxorubicin.	[58]
Capecitabine	DMTS85L	Approved	Stress-induced-phosphoprotein 1 (STIP1) decreases the response to substance of Capecitabine.	[59]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[32]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[32]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[37]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[38]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[39]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[40]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[41]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[42]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[43]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[44]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[45]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[45]
Haloperidol	DM96SE0	Approved	Haloperidol decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[45]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[46]
Tubocurarine	DMBZIVP	Approved	Tubocurarine decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[43]
Mecamylamine	DMGQFYB	Approved	Mecamylamine decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[47]
Celastrol	DMWQIJX	Preclinical	Celastrol increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[51]
EMODIN	DMAEDQG	Terminated	EMODIN decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[52]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[53]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[55]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[56]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Stress-induced-phosphoprotein 1 (STIP1).	[57]

1 Drug(s) Affected the Biochemical Pathways of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB increases the metabolism of Stress-induced-phosphoprotein 1 (STIP1).	[48]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Stress-induced-phosphoprotein 1 (STIP1).	[49]
TAK-243	DM4GKV2	Phase 1	TAK-243 affects the sumoylation of Stress-induced-phosphoprotein 1 (STIP1).	[50]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Stress-induced-phosphoprotein 1 (STIP1).	[54]

References

• [1] RETRACTED: Stress induced phosphoprotein 1 promotes tumor growth and metastasis of melanoma via modulating JAK2/STAT3 pathway.Biomed Pharmacother. 2019 Aug;116:108962. doi: 10.1016/j.biopha.2019.108962. Epub 2019 May 16.
• [2] Down-regulation of STIP1 regulate apoptosis and invasion of glioma cells via TRAP1/AKT signaling pathway.Cancer Genet. 2019 Sep;237:1-9. doi: 10.1016/j.cancergen.2019.05.006. Epub 2019 Jun 3.
• [3] Revealing the interaction mode of the highly flexible Sorghum bicolor Hsp70/Hsp90 organizing protein (Hop): A conserved carboxylate clamp confers high affinity binding to Hsp90.J Proteomics. 2019 Jan 16;191:191-201. doi: 10.1016/j.jprot.2018.02.007. Epub 2018 Feb 6.
• [4] The Hsp70/Hsp90 Chaperone Machinery in Neurodegenerative Diseases.Front Neurosci. 2017 May 16;11:254. doi: 10.3389/fnins.2017.00254. eCollection 2017.
• [5] Amino Acid-Based Metabolic Panel Provides Robust Prognostic Value Additive to B-Natriuretic Peptide and Traditional Risk Factors in Heart Failure.Dis Markers. 2018 Oct 10;2018:3784589. doi: 10.1155/2018/3784589. eCollection 2018.
• [6] A 60 kd MDM2 isoform is produced by caspase cleavage in non-apoptotic tumor cells.Oncogene. 1998 Nov 19;17(20):2629-36. doi: 10.1038/sj.onc.1202206.
• [7] Day-by-Day Variability of Home Blood Pressure and Incident Cardiovascular Disease in Clinical Practice: The J-HOP Study (Japan Morning Surge-Home Blood Pressure).Hypertension. 2018 Jan;71(1):177-184. doi: 10.1161/HYPERTENSIONAHA.117.10385. Epub 2017 Nov 13.
• [8] Molecular, biochemical, and functional characteristics of tumor necrosis factor-alpha produced by human placental cytotrophoblastic cells.J Immunol. 1993 Jun 15;150(12):5614-24.
• [9] Aberrant expression of stress-induced phosphoprotein 1 in colorectal cancer and its clinicopathologic significance.Hum Pathol. 2018 Sep;79:135-143. doi: 10.1016/j.humpath.2018.05.016. Epub 2018 Jun 5.
• [10] Hsp 70/Hsp 90 organizing protein as a nitrosylation target in cystic fibrosis therapy.Proc Natl Acad Sci U S A. 2010 Jun 22;107(25):11393-8. doi: 10.1073/pnas.0909128107. Epub 2010 Jun 8.
• [11] Possible involvement of signal transducers and activators of transcription 3 system on depression in the model mice brain.Biol Pharm Bull. 2010;33(4):636-40. doi: 10.1248/bpb.33.636.
• [12] Associations between a single nucleotide polymorphism of stress-induced phosphoprotein 1 and endometriosis/adenomyosis.Taiwan J Obstet Gynecol. 2018 Apr;57(2):270-275. doi: 10.1016/j.tjog.2018.03.001.
• [13] Identification of cell membrane protein stress-induced phosphoprotein 1 as a potential ovarian cancer biomarker using aptamers selected by cell systematic evolution of ligands by exponential enrichment.Anal Chem. 2014 May 6;86(9):4521-7. doi: 10.1021/ac500466x. Epub 2014 Apr 9.
• [14] Serum Autoantibodies against STIP1 as a Potential Biomarker in the Diagnosis of Esophageal Squamous Cell Carcinoma.Dis Markers. 2017;2017:5384091. doi: 10.1155/2017/5384091. Epub 2017 Aug 9.
• [15] Stress-induced phosphoprotein 1 mediates hepatocellular carcinoma metastasis after insufficient radiofrequency ablation.Oncogene. 2018 Jun;37(26):3514-3527. doi: 10.1038/s41388-018-0169-4. Epub 2018 Mar 21.
• [16] STIP1 Regulates Proliferation and Migration of Lung Adenocarcinoma Through JAK2/STAT3 Signaling Pathway.Cancer Manag Res. 2019 Nov 29;11:10061-10072. doi: 10.2147/CMAR.S233758. eCollection 2019.
• [17] Epigenetic and genetic inactivation of tyrosyl-DNA-phosphodiesterase 1 (TDP1) in human lung cancer cells from the NCI-60 panel.DNA Repair (Amst). 2014 Jan;13:1-9. doi: 10.1016/j.dnarep.2013.09.001. Epub 2013 Dec 16.
• [18] Altered Transcranial Magnetic Stimulation-Electroencephalographic Markers of Inhibition and Excitation in the Dorsolateral Prefrontal Cortex in Major Depressive Disorder.Biol Psychiatry. 2019 Mar 15;85(6):477-486. doi: 10.1016/j.biopsych.2018.09.032. Epub 2018 Oct 18.
• [19] Targeting proprotein convertases in furin-rich lung cancer cells results in decreased in vitro and in vivo growth.Mol Carcinog. 2017 Mar;56(3):1182-1188. doi: 10.1002/mc.22550. Epub 2016 Sep 22.
• [20] The heat shock protein 70 inhibitor VER155008 suppresses the expression of HSP27, HOP and HSP90 and the androgen receptor, induces apoptosis, and attenuates prostate cancer cell growth.J Cell Biochem. 2020 Jan;121(1):407-417. doi: 10.1002/jcb.29195. Epub 2019 Jun 21.
• [21] Recurrent fusion transcripts in squamous cell carcinomas of the vulva.Oncotarget. 2017 Mar 7;8(10):16843-16850. doi: 10.18632/oncotarget.15167.
• [22] Autoantibodies against stress-induced phosphoprotein-1 as a novel biomarker candidate for ovarian cancer.Genes Chromosomes Cancer. 2010 Jul;49(7):585-95. doi: 10.1002/gcc.20769.
• [23] STIP1 Tissue Expression Is Associated with Survival in Chemotherapy-Treated Bladder Cancer Patients.Pathol Oncol Res. 2020 Apr;26(2):1243-1249. doi: 10.1007/s12253-019-00689-y. Epub 2019 Jun 27.
• [24] Autocrine and paracrine STIP1 signaling promote osteolytic bone metastasis in renal cell carcinoma.Oncotarget. 2017 Mar 7;8(10):17012-17026. doi: 10.18632/oncotarget.15222.
• [25] Stress-inducible Protein-1 promotes metastasis of gastric cancer via Wnt/-catenin signaling pathway.J Exp Clin Cancer Res. 2018 Jan 15;37(1):6. doi: 10.1186/s13046-018-0676-8.
• [26] Stress-induced phosphoprotein 1 promotes pancreatic cancer progression through activation of the FAK/AKT/MMP signaling axis.Pathol Res Pract. 2019 Nov;215(11):152564. doi: 10.1016/j.prp.2019.152564. Epub 2019 Jul 25.
• [27] STI1 promotes glioma proliferation through MAPK and PI3K pathways.Glia. 2007 Dec;55(16):1690-8. doi: 10.1002/glia.20579.
• [28] GLCCI1 and STIP1 variants are associated with asthma susceptibility and inhaled corticosteroid response in a Tunisian population.J Asthma. 2021 Feb;58(2):197-206. doi: 10.1080/02770903.2019.1666867. Epub 2019 Sep 24.
• [29] Co-variation of STI1 and WDR36/UTP21 alters cell proliferation in a glaucoma model.Mol Vis. 2011;17:1957-69. Epub 2011 Jul 19.
• [30] Mild Hypobaric Hypoxia Enhances Post-exercise Vascular Responses in Young Male Runners.Front Physiol. 2019 May 24;10:546. doi: 10.3389/fphys.2019.00546. eCollection 2019.
• [31] Mechanisms of neuroprotection against ischemic insult by stress-inducible phosphoprotein-1/prion protein complex.J Neurochem. 2018 Apr;145(1):68-79. doi: 10.1111/jnc.14281. Epub 2018 Jan 12.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [36] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [37] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [38] Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
• [39] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [40] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [41] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [42] Proteomic analysis of anti-cancer effects by paclitaxel treatment in cervical cancer cells. Gynecol Oncol. 2005 Jul;98(1):45-53. doi: 10.1016/j.ygyno.2005.04.010.
• [43] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [44] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [45] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [46] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [47] Proteomic profiling reveals that resveratrol inhibits HSP27 expression and sensitizes breast cancer cells to doxorubicin therapy. PLoS One. 2013 May 27;8(5):e64378.
• [48] Determination of Protein Haptenation by Chemical Sensitizers Within the Complexity of the Human Skin Proteome. Toxicol Sci. 2018 Apr 1;162(2):429-438. doi: 10.1093/toxsci/kfx265.
• [49] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [50] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [51] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [52] Gene expression alteration during redox-dependent enhancement of arsenic cytotoxicity by emodin in HeLa cells. Cell Res. 2005 Jul;15(7):511-22.
• [53] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [54] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [55] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [56] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [57] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [58] Nuclear proteomics with XRCC3 knockdown to reveal the development of doxorubicin-resistant uterine cancer. Toxicol Sci. 2014 Jun;139(2):396-406. doi: 10.1093/toxsci/kfu051. Epub 2014 Mar 27.
• [59] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.