Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8V1J4M)

• DOT Name: Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G)
• Synonyms: Cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein; DDIT-2
• Gene Name: GADD45G
• Related Disease:
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Adenoma
  Advanced cancer
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Carcinoma of esophagus
  Chromosomal disorder
  Clear cell renal carcinoma
  Cognitive impairment
  Disorder of sexual differentiation
  Esophageal cancer
  Gastric cancer
  Herpes simplex infection
  Intestinal neoplasm
  Isolated cleft lip
  Laryngeal disorder
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Male infertility
  Neoplasm
  Neoplasm of esophagus
  Nephropathy
  Non-small-cell lung cancer
  Prostate neoplasm
  Skin disease
  Stomach cancer
  Teratoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid gland undifferentiated (anaplastic) carcinoma
  Thyroid tumor
  Urinary bladder cancer
  Urinary bladder neoplasm
  Cardiovascular disease
  Nasopharyngeal carcinoma
  Allergic contact dermatitis
  Asthma
  Digestive system neoplasm
  Granular corneal dystrophy type II
  Pituitary tumor
  Prostate cancer
  Prostate carcinoma
  Pulmonary disease
• UniProt ID: GA45G_HUMAN
• PDB ID: 2WAL; 3FFM
• Pfam ID: PF01248
• Sequence:
  MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
  VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
  LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
• Function: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  NF-kappa B sig.ling pathway (hsa04064)
  FoxO sig.ling pathway (hsa04068)
  Cell cycle (hsa04110)
  p53 sig.ling pathway (hsa04115)
  Apoptosis (hsa04210)
  Cellular senescence (hsa04218)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  Transcriptio.l misregulation in cancer (hsa05202)
  Colorectal cancer (hsa05210)
  Pancreatic cancer (hsa05212)
  Endometrial cancer (hsa05213)
  Glioma (hsa05214)
  Thyroid cancer (hsa05216)
  Basal cell carcinoma (hsa05217)
  Melanoma (hsa05218)
  Chronic myeloid leukemia (hsa05220)
  Small cell lung cancer (hsa05222)
  Non-small cell lung cancer (hsa05223)
  Breast cancer (hsa05224)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Definitive	Biomarker	[1]
Liver cancer	DISDE4BI	Definitive	Biomarker	[1]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[3]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Carcinoma of esophagus	DISS6G4D	Strong	Posttranslational Modification	[6]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Cognitive impairment	DISH2ERD	Strong	Biomarker	[9]
Disorder of sexual differentiation	DISRMAEZ	Strong	Biomarker	[10]
Esophageal cancer	DISGB2VN	Strong	Posttranslational Modification	[6]
Gastric cancer	DISXGOUK	Strong	Biomarker	[11]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[12]
Intestinal neoplasm	DISK0GUH	Strong	Biomarker	[13]
Isolated cleft lip	DIS2O2JV	Strong	Genetic Variation	[14]
Laryngeal disorder	DISDKUQO	Strong	Biomarker	[11]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Lung neoplasm	DISVARNB	Strong	Biomarker	[16]
Male infertility	DISY3YZZ	Strong	Biomarker	[10]
Neoplasm	DISZKGEW	Strong	Posttranslational Modification	[17]
Neoplasm of esophagus	DISOLKAQ	Strong	Posttranslational Modification	[6]
Nephropathy	DISXWP4P	Strong	Altered Expression	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[19]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[20]
Skin disease	DISDW8R6	Strong	Genetic Variation	[21]
Stomach cancer	DISKIJSX	Strong	Biomarker	[22]
Teratoma	DIS6ICY4	Strong	Biomarker	[23]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[11]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[11]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Strong	Biomarker	[24]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[11]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[4]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[25]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[26]
Allergic contact dermatitis	DISFFVF9	Limited	Biomarker	[27]
Asthma	DISW9QNS	Limited	Biomarker	[28]
Digestive system neoplasm	DISPOJCT	Limited	Biomarker	[29]
Granular corneal dystrophy type II	DISAEE20	Limited	Genetic Variation	[27]
Pituitary tumor	DISN67JD	Limited	Altered Expression	[30]
Prostate cancer	DISF190Y	Limited	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[20]
Pulmonary disease	DIS6060I	Limited	Biomarker	[31]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[37]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[39]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[39]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[41]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[42]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[43]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[44]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[45]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[46]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[47]
Sorafenib	DMS8IFC	Approved	Sorafenib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[48]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[49]
Febuxostat	DMDEXQ0	Approved	Febuxostat increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[50]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[51]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[44]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[52]
Abexinostat	DM91LGU	Phase 3	Abexinostat increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[53]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[54]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[55]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[57]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[58]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[60]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[61]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[62]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G).	[59]

References

• [1] Expression of Clusterin suppresses Cr(VI)-induced premature senescence through activation of PI3K/AKT pathway.Ecotoxicol Environ Saf. 2019 Nov 15;183:109465. doi: 10.1016/j.ecoenv.2019.109465. Epub 2019 Jul 31.
• [2] Expression analysis of GADD45, MEG3, and p8 in pituitary adenomas.Horm Metab Res. 2014 Aug;46(9):644-50. doi: 10.1055/s-0034-1383566. Epub 2014 Aug 15.
• [3] Impact of wood combustion on indoor air quality.Sci Total Environ. 2020 Feb 25;705:135769. doi: 10.1016/j.scitotenv.2019.135769. Epub 2019 Nov 27.
• [4] Transcriptional regulatory networks in human lung adenocarcinoma.Mol Med Rep. 2012 Nov;6(5):961-6. doi: 10.3892/mmr.2012.1034. Epub 2012 Aug 14.
• [5] (--)-Xanthatin selectively induces GADD45 and stimulates caspase-independent cell death in human breast cancer MDA-MB-231 cells.Chem Res Toxicol. 2011 Jun 20;24(6):855-65. doi: 10.1021/tx200046s. Epub 2011 May 13.
• [6] Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression and poor prognosis in esophageal squamous cell carcinoma.Clin Exp Metastasis. 2013 Dec;30(8):977-92. doi: 10.1007/s10585-013-9597-2. Epub 2013 Jun 21.
• [7] XRCC1 protects cells from chromate-induced chromosome damage, but does not affect cytotoxicity.Mutat Res. 2006 Nov 7;610(1-2):31-7. doi: 10.1016/j.mrgentox.2006.06.010. Epub 2006 Aug 14.
• [8] Role of inflammatory related gene expression in clear cell renal cell carcinoma development and clinical outcomes.J Urol. 2011 Nov;186(5):2071-7. doi: 10.1016/j.juro.2011.06.049. Epub 2011 Sep 23.
• [9] Mimicking Age-Associated Gadd45 Dysregulation Results in Memory Impairments in Young Adult Mice.J Neurosci. 2020 Feb 5;40(6):1197-1210. doi: 10.1523/JNEUROSCI.1621-19.2019. Epub 2019 Dec 11.
• [10] Gadd45g is essential for primary sex determination, male fertility and testis development.PLoS One. 2013;8(3):e58751. doi: 10.1371/journal.pone.0058751. Epub 2013 Mar 13.
• [11] The Effect of Hexavalent Chromium on the Incidence and Mortality of Human Cancers: A Meta-Analysis Based on Published Epidemiological Cohort Studies.Front Oncol. 2019 Feb 4;9:24. doi: 10.3389/fonc.2019.00024. eCollection 2019.
• [12] GADD45 Activated Early in the Course of Herpes Simplex Virus 1 Infection Suppresses the Activation of a Network of Innate Immunity Genes.J Virol. 2019 Mar 21;93(7):e02201-18. doi: 10.1128/JVI.02201-18. Print 2019 Apr 1.
• [13] Integration of mechanistic and pharmacokinetic information to derive oral reference dose and margin-of-exposure values for hexavalent chromium.J Appl Toxicol. 2018 Mar;38(3):351-365. doi: 10.1002/jat.3545. Epub 2017 Oct 24.
• [14] Mutations of GADD45G in rabbits cause cleft lip by the disorder of proliferation, apoptosis and epithelial-mesenchymal transition (EMT).Biochim Biophys Acta Mol Basis Dis. 2019 Sep 1;1865(9):2356-2367. doi: 10.1016/j.bbadis.2019.05.015. Epub 2019 May 29.
• [15] Review of transcriptomic responses to hexavalent chromium exposure in lung cells supports a role of epigenetic mediators in carcinogenesis. Toxicol Lett. 2019 May 1;305:40-50.
• [16] Paired box 5 is a frequently methylated lung cancer tumour suppressor gene interfering -catenin signalling and GADD45G expression.J Cell Mol Med. 2016 May;20(5):842-54. doi: 10.1111/jcmm.12768. Epub 2016 Feb 4.
• [17] Chromium disrupts chromatin organization and CTCF access to its cognate sites in promoters of differentially expressed genes.Epigenetics. 2018;13(4):363-375. doi: 10.1080/15592294.2018.1454243. Epub 2018 May 3.
• [18] Metabolic adaptability in hexavalent chromium-treated renal tissue: an in vivo study.Clin Kidney J. 2018 Apr;11(2):222-229. doi: 10.1093/ckj/sfx069. Epub 2017 Jul 27.
• [19] Genetic variants of JNK and p38 pathways and risk of non-small cell lung cancer in an Eastern Chinese population.Int J Cancer. 2017 Feb 15;140(4):807-817. doi: 10.1002/ijc.30508. Epub 2016 Nov 16.
• [20] Chromium(VI) promotes cell migration through targeting epithelial-mesenchymal transition in prostate cancer.Toxicol Lett. 2019 Jan;300:10-17. doi: 10.1016/j.toxlet.2018.10.012. Epub 2018 Oct 10.
• [21] A retrospective investigation of hexavalent chromium allergy in southern Sweden.Contact Dermatitis. 2018 Jun;78(6):386-392. doi: 10.1111/cod.12969. Epub 2018 Mar 23.
• [22] Hexavalent chromium and stomach cancer: a systematic review and meta-analysis.Crit Rev Toxicol. 2019 Feb;49(2):140-159. doi: 10.1080/10408444.2019.1578730. Epub 2019 Mar 21.
• [23] Differential responses to genotoxic agents between induced pluripotent stem cells and tumor cell lines.J Hematol Oncol. 2013 Sep 20;6(1):71. doi: 10.1186/1756-8722-6-71.
• [24] Gadd45gamma expression is reduced in anaplastic thyroid cancer and its reexpression results in apoptosis.J Clin Endocrinol Metab. 2003 Aug;88(8):3913-20. doi: 10.1210/jc.2002-022031.
• [25] Toxic effects of Cr(VI) on the bovine hemoglobin and human vascular endothelial cells: Molecular interaction and cell damage.Chemosphere. 2019 May;222:355-363. doi: 10.1016/j.chemosphere.2019.01.137. Epub 2019 Jan 24.
• [26] GADD45 induces G2/M arrest in human pharynx and nasopharyngeal carcinoma cells by cucurbitacin E.Sci Rep. 2014 Sep 23;4:6454. doi: 10.1038/srep06454.
• [27] Skin application of glutathione and iron sulfate can inhibit elicitation of allergic contact dermatitis from hexavalent chromium.Contact Dermatitis. 2020 Jan;82(1):45-53. doi: 10.1111/cod.13409. Epub 2019 Nov 14.
• [28] Metallurgical residues reused as filler after 35years and their natural weathering implications in a mountain area.Sci Total Environ. 2018 Mar 15;618:39-47. doi: 10.1016/j.scitotenv.2017.11.026. Epub 2017 Nov 7.
• [29] Ten factors for considering the mode of action of Cr(VI)-induced gastrointestinal tumors in rodents.Mutat Res Genet Toxicol Environ Mutagen. 2017 Nov;823:45-57. doi: 10.1016/j.mrgentox.2017.08.004. Epub 2017 Sep 12.
• [30] Loss of expression of GADD45 gamma, a growth inhibitory gene, in human pituitary adenomas: implications for tumorigenesis.J Clin Endocrinol Metab. 2002 Mar;87(3):1262-7. doi: 10.1210/jcem.87.3.8315.
• [31] Role of LKB1 in migration and invasion of Cr(VI)-transformed human bronchial epithelial Beas-2B cells.Anticancer Drugs. 2018 Aug;29(7):660-673. doi: 10.1097/CAD.0000000000000638.
• [32] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [33] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [34] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [35] Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
• [38] Profile of estrogen-responsive genes in an estrogen-specific mammary gland outgrowth model. Mol Reprod Dev. 2009 Aug;76(8):733-50. doi: 10.1002/mrd.21041.
• [39] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [40] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [41] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [42] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [43] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [44] SIRT1 activation enhances HDAC inhibition-mediated upregulation of GADD45G by repressing the binding of NF-B/STAT3 complex to its promoter in malignant lymphoid cells. Cell Death Dis. 2013 May 16;4(5):e635. doi: 10.1038/cddis.2013.159.
• [45] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [46] The proteasome inhibitor bortezomib induces apoptosis in human retinoblastoma cell lines in vitro. Invest Ophthalmol Vis Sci. 2007 Oct;48(10):4706-19. doi: 10.1167/iovs.06-1147.
• [47] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [48] Growth arrest DNA damage-inducible gene 45 gamma expression as a prognostic and predictive biomarker in hepatocellular carcinoma. Oncotarget. 2015 Sep 29;6(29):27953-65. doi: 10.18632/oncotarget.4446.
• [49] Identification of genes linked to gefitinib treatment in prostate cancer cell lines with or without resistance to androgen: a clue to application of gefitinib to hormone-resistant prostate cancer. Oncol Rep. 2006 Jun;15(6):1453-60.
• [50] Febuxostat Increases Ventricular Arrhythmogenesis Through Calcium Handling Dysregulation in Human-Induced Pluripotent Stem Cell-Derived Cardiomyocytes. Toxicol Sci. 2022 Sep 24;189(2):216-224. doi: 10.1093/toxsci/kfac073.
• [51] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [52] Myristicin from nutmeg induces apoptosis via the mitochondrial pathway and down regulates genes of the DNA damage response pathways in human leukaemia K562 cells. Chem Biol Interact. 2014 Jul 25;218:1-9. doi: 10.1016/j.cbi.2014.04.014. Epub 2014 Apr 29.
• [53] HDAC inhibitor PCI-24781 decreases RAD51 expression and inhibits homologous recombination. Proc Natl Acad Sci U S A. 2007 Dec 4;104(49):19482-7. doi: 10.1073/pnas.0707828104. Epub 2007 Nov 27.
• [54] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [55] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [56] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [57] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [58] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [59] Bisphenol-A impairs cellular function and alters DNA methylation of stress pathway genes in first trimester trophoblast cells. Reprod Toxicol. 2018 Dec;82:72-79.
• [60] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [61] Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
• [62] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.