Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9AKFVS)

• DOT Name: Metallothionein-1X (MT1X)
• Synonyms: MT-1X; Metallothionein-IX; MT-IX
• Gene Name: MT1X
• Related Disease:
  Colorectal carcinoma
  Advanced cancer
  Amyotrophic lateral sclerosis type 1
  Androgen insensitivity syndrome
  Bladder cancer
  Breast carcinoma
  Classic Hodgkin lymphoma
  Colonic neoplasm
  Creutzfeldt Jacob disease
  Glioma
  Graves disease
  Huntington disease
  Laryngeal carcinoma
  Laryngeal squamous cell carcinoma
  Lung cancer
  Lung carcinoma
  Lymphosarcoma
  Malignant pleural mesothelioma
  Nephritis
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Thyroid gland papillary carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Wilson disease
  Squamous cell carcinoma
  Prostate cancer
  Prostate carcinoma
  Breast cancer
  Breast neoplasm
  Glaucoma/ocular hypertension
  Lupus nephritis
  Stroke
  Systemic lupus erythematosus
• UniProt ID: MT1X_HUMAN
• Pfam ID: PF00131
• Sequence:
  MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC
  A
• Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling.
• KEGG Pathway: Mineral absorption (hsa04978)
• Reactome Pathway: Metallothioneins bind metals (R-HSA-5661231)

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Strong	Biomarker	[3]
Androgen insensitivity syndrome	DISUZBBO	Strong	Altered Expression	[4]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[7]
Colonic neoplasm	DISSZ04P	Strong	Posttranslational Modification	[8]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Biomarker	[9]
Glioma	DIS5RPEH	Strong	Biomarker	[10]
Graves disease	DISU4KOQ	Strong	Biomarker	[11]
Huntington disease	DISQPLA4	Strong	Altered Expression	[12]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[13]
Laryngeal squamous cell carcinoma	DIS9UUVF	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Lymphosarcoma	DISGYV3F	Strong	Posttranslational Modification	[15]
Malignant pleural mesothelioma	DIST2R60	Strong	Biomarker	[2]
Nephritis	DISQZQ70	Strong	Altered Expression	[16]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[14]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[18]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[5]
Wilson disease	DISVS9H7	Strong	Biomarker	[19]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[20]
Prostate cancer	DISF190Y	Disputed	Altered Expression	[21]
Prostate carcinoma	DISMJPLE	Disputed	Altered Expression	[21]
Breast cancer	DIS7DPX1	Limited	Biomarker	[6]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[22]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Genetic Variation	[23]
Lupus nephritis	DISCVGPZ	Limited	Altered Expression	[16]
Stroke	DISX6UHX	Limited	Biomarker	[24]
Systemic lupus erythematosus	DISI1SZ7	Limited	Altered Expression	[16]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	Metallothionein-1X (MT1X) affects the response to substance of DTI-015.	[76]

54 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Metallothionein-1X (MT1X).	[25]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Metallothionein-1X (MT1X).	[26]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Metallothionein-1X (MT1X).	[27]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Metallothionein-1X (MT1X).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Metallothionein-1X (MT1X).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Metallothionein-1X (MT1X).	[30]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Metallothionein-1X (MT1X).	[31]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Metallothionein-1X (MT1X).	[32]
Quercetin	DM3NC4M	Approved	Quercetin affects the expression of Metallothionein-1X (MT1X).	[33]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Metallothionein-1X (MT1X).	[34]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Metallothionein-1X (MT1X).	[35]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Metallothionein-1X (MT1X).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Metallothionein-1X (MT1X).	[37]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Metallothionein-1X (MT1X).	[38]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Metallothionein-1X (MT1X).	[37]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Metallothionein-1X (MT1X).	[39]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Metallothionein-1X (MT1X).	[40]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Metallothionein-1X (MT1X).	[36]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Metallothionein-1X (MT1X).	[41]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Metallothionein-1X (MT1X).	[42]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Metallothionein-1X (MT1X).	[43]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Metallothionein-1X (MT1X).	[44]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Metallothionein-1X (MT1X).	[45]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Metallothionein-1X (MT1X).	[46]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Metallothionein-1X (MT1X).	[47]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Metallothionein-1X (MT1X).	[48]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone increases the expression of Metallothionein-1X (MT1X).	[49]
Bosentan	DMIOGBU	Approved	Bosentan increases the expression of Metallothionein-1X (MT1X).	[50]
Penicillamine	DM40EF6	Approved	Penicillamine decreases the expression of Metallothionein-1X (MT1X).	[19]
Promegestone	DMK4S8I	Approved	Promegestone increases the expression of Metallothionein-1X (MT1X).	[52]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Metallothionein-1X (MT1X).	[53]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Metallothionein-1X (MT1X).	[54]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Metallothionein-1X (MT1X).	[55]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Metallothionein-1X (MT1X).	[56]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Metallothionein-1X (MT1X).	[57]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of Metallothionein-1X (MT1X).	[58]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Metallothionein-1X (MT1X).	[59]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Metallothionein-1X (MT1X).	[60]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Metallothionein-1X (MT1X).	[61]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Metallothionein-1X (MT1X).	[62]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Metallothionein-1X (MT1X).	[63]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Metallothionein-1X (MT1X).	[64]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Metallothionein-1X (MT1X).	[65]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Metallothionein-1X (MT1X).	[66]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Metallothionein-1X (MT1X).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Metallothionein-1X (MT1X).	[67]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Metallothionein-1X (MT1X).	[68]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Metallothionein-1X (MT1X).	[69]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Metallothionein-1X (MT1X).	[70]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Metallothionein-1X (MT1X).	[71]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the expression of Metallothionein-1X (MT1X).	[72]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the expression of Metallothionein-1X (MT1X).	[73]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Metallothionein-1X (MT1X).	[74]
Genistein-7-glucoside	DMMLNTW	Investigative	Genistein-7-glucoside increases the expression of Metallothionein-1X (MT1X).	[75]

References

• [1] T([20]) repeat in the 3'-untranslated region of the MT1X gene: a marker with high sensitivity and specificity to detect microsatellite instability in colorectal cancer.Int J Colorectal Dis. 2012 May;27(5):647-56. doi: 10.1007/s00384-011-1365-7. Epub 2011 Nov 23.
• [2] Immunohistochemically detectable metallothionein expression in malignant pleural mesotheliomas is strongly associated with early failure to platin-based chemotherapy.Oncotarget. 2018 Apr 27;9(32):22254-22268. doi: 10.18632/oncotarget.24962. eCollection 2018 Apr 27.
• [3] Reduction of metallothioneins promotes the disease expression of familial amyotrophic lateral sclerosis mice in a dose-dependent manner.Eur J Neurosci. 2001 Apr;13(7):1363-70. doi: 10.1046/j.0953-816x.2001.01512.x.
• [4] Abnormal melatonin receptor 1B expression in osteoblasts from girls with adolescent idiopathic scoliosis.J Pineal Res. 2011 May;50(4):395-402. doi: 10.1111/j.1600-079X.2011.00857.x. Epub 2011 Feb 24.
• [5] Metallothionein isoform 1 and 2 gene expression in the human bladder: evidence for upregulation of MT-1X mRNA in bladder cancer.Cancer Detect Prev. 2001;25(1):62-75.
• [6] A case-control study of Metallothionein-1 expression in breast cancer and breast fibroadenoma.Sci Rep. 2019 May 15;9(1):7407. doi: 10.1038/s41598-019-43565-0.
• [7] A novel MspI PCR-RFLP in the human cytosine 5-methyltransferase gene: lack of relevance for malignant lymphoproliferative disease and breast cancer.Hum Hered. 1998 Jul-Aug;48(4):226-9. doi: 10.1159/000022805.
• [8] Induction of apoptosis by wild-type p53 in a human colon tumor-derived cell line.Proc Natl Acad Sci U S A. 1992 May 15;89(10):4495-9. doi: 10.1073/pnas.89.10.4495.
• [9] Differential expression of metallothioneins in human prion diseases.Dement Geriatr Cogn Disord. 2000 Sep-Oct;11(5):251-62. doi: 10.1159/000017247.
• [10] The melatonin-MT1 receptor axis modulates tumor growth in PTEN-mutated gliomas.Biochem Biophys Res Commun. 2018 Feb 19;496(4):1322-1330. doi: 10.1016/j.bbrc.2018.02.010.
• [11] Expression of Metallothionein I/II and Ki-67 Antigen in Graves' Disease.Anticancer Res. 2018 Dec;38(12):6847-6853. doi: 10.21873/anticanres.13059.
• [12] The melatonin MT1 receptor axis modulates mutant Huntingtin-mediated toxicity.J Neurosci. 2011 Oct 12;31(41):14496-507. doi: 10.1523/JNEUROSCI.3059-11.2011.
• [13] Potential biomarkers for head and neck squamous cell carcinoma.Laryngoscope. 2003 Mar;113(3):393-400. doi: 10.1097/00005537-200303000-00001.
• [14] Systematic analysis of mRNA expression profiles in NSCLC cell lines to screen metastasis-related genes.Mol Med Rep. 2016 Dec;14(6):5093-5103. doi: 10.3892/mmr.2016.5911. Epub 2016 Nov 1.
• [15] Physical and functional interaction of DNA methyltransferase 3A with Mbd3 and Brg1 in mouse lymphosarcoma cells.Cancer Res. 2005 Dec 1;65(23):10891-900. doi: 10.1158/0008-5472.CAN-05-1455.
• [16] The renal metallothionein expression profile is altered in human lupus nephritis.Arthritis Res Ther. 2008;10(4):R76. doi: 10.1186/ar2450. Epub 2008 Jul 6.
• [17] Metallothionein 1 negatively regulates glucose-stimulated insulin secretion and is differentially expressed in conditions of beta cell compensation and failure in mice and humans.Diabetologia. 2019 Dec;62(12):2273-2286. doi: 10.1007/s00125-019-05008-3. Epub 2019 Oct 17.
• [18] Metallothionein Isoform Expression in Benign and Malignant Thyroid Lesions.Anticancer Res. 2017 Sep;37(9):5179-5185. doi: 10.21873/anticanres.11940.
• [19] The effect of zinc and D-penicillamine in a stable human hepatoma ATP7B knockout cell line. PLoS One. 2014 Jun 3;9(6):e98809. doi: 10.1371/journal.pone.0098809. eCollection 2014.
• [20] Microarray-assisted pathway analysis identifies MT1X & NFB as mediators of TCRP1-associated resistance to cisplatin in oral squamous cell carcinoma.PLoS One. 2012;7(12):e51413. doi: 10.1371/journal.pone.0051413. Epub 2012 Dec 10.
• [21] Melatonin MT1 receptor-induced transcriptional up-regulation of p27(Kip1) in prostate cancer antiproliferation is mediated via inhibition of constitutively active nuclear factor kappa B (NF-B): potential implications on prostate cancer chemoprevention and therapy.J Pineal Res. 2013 Jan;54(1):69-79. doi: 10.1111/j.1600-079X.2012.01026.x. Epub 2012 Aug 1.
• [22] Immunohistochemical Expression of Melatonin Receptor MT1 and Glucose Transporter GLUT1 in Human Breast Cancer.Anticancer Agents Med Chem. 2018;18(15):2110-2116. doi: 10.2174/1871520618666181025125532.
• [23] Variations in the myocilin gene in patients with open-angle glaucoma.Arch Ophthalmol. 2002 Sep;120(9):1189-97. doi: 10.1001/archopht.120.9.1189.
• [24] Metallothionein I as a direct link between therapeutic hematopoietic stem/progenitor cells and cerebral protection in stroke.FASEB J. 2018 May;32(5):2381-2394. doi: 10.1096/fj.201700746R. Epub 2017 Dec 21.
• [25] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [26] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [27] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [28] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [31] Human drug metabolism genes in parathion-and estrogen-treated breast cells. Int J Mol Med. 2007 Dec;20(6):875-81.
• [32] Heavy metal responses of the human metallothionein isoform genes. Yakugaku Zasshi. 2007 Apr;127(4):665-73.
• [33] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [34] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [35] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [36] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [37] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [38] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [39] The human colon cancer methylome shows similar hypo- and hypermethylation at conserved tissue-specific CpG island shores. Nat Genet. 2009 Feb;41(2):178-186.
• [40] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [41] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [42] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [43] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [44] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [45] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [46] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [47] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [48] Motexafin gadolinium disrupts zinc metabolism in human cancer cell lines. Cancer Res. 2005 May 1;65(9):3837-45.
• [49] Ultradian cortisol pulsatility encodes a distinct, biologically important signal. PLoS One. 2011 Jan 18;6(1):e15766.
• [50] Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
• [51] The effect of zinc and D-penicillamine in a stable human hepatoma ATP7B knockout cell line. PLoS One. 2014 Jun 3;9(6):e98809. doi: 10.1371/journal.pone.0098809. eCollection 2014.
• [52] Short-chain fatty acids enhance nuclear receptor activity through mitogen-activated protein kinase activation and histone deacetylase inhibition. Proc Natl Acad Sci U S A. 2004 May 4;101(18):7199-204.
• [53] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [54] Up-regulation of endothelial nitric oxide synthase (eNOS), silent mating type information regulation 2 homologue 1 (SIRT1) and autophagy-related genes by repeated treatments with resveratrol in human umbilical vein endothelial cells. Br J Nutr. 2013 Dec;110(12):2150-5.
• [55] Dietary catechins and procyanidins modulate zinc homeostasis in human HepG2 cells. J Nutr Biochem. 2011 Feb;22(2):153-63.
• [56] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [57] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [58] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [59] Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
• [60] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [61] Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
• [62] High-throughput cell-based screening of 4910 known drugs and drug-like small molecules identifies disulfiram as an inhibitor of prostate cancer cell growth. Clin Cancer Res. 2009 Oct 1;15(19):6070-8.
• [63] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [64] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [65] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [66] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [67] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [68] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [69] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [70] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [71] In vitro evaluation of the toxicity induced by nickel soluble and particulate forms in human airway epithelial cells. Toxicol In Vitro. 2011 Mar;25(2):454-61. doi: 10.1016/j.tiv.2010.11.013. Epub 2010 Nov 25.
• [72] Identification of palmitate-regulated genes in HepG2 cells by applying microarray analysis. Biochim Biophys Acta. 2007 Sep;1770(9):1283-8. doi: 10.1016/j.bbagen.2007.07.001. Epub 2007 Jul 10.
• [73] Analysis of lead toxicity in human cells. BMC Genomics. 2012 Jul 27;13:344.
• [74] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.
• [75] Water-soluble genistin glycoside isoflavones up-regulate antioxidant metallothionein expression and scavenge free radicals. J Agric Food Chem. 2006 May 31;54(11):3819-26.
• [76] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.