Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9KIQ0Y)

• DOT Name: Annexin A6 (ANXA6)
• Synonyms: 67 kDa calelectrin; Annexin VI; Annexin-6; Calphobindin-II; CPB-II; Chromobindin-20; Lipocortin VI; Protein III; p68; p70
• Gene Name: ANXA6
• Related Disease:
  Bone osteosarcoma
  Osteosarcoma
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiac failure
  Cerebral infarction
  Cervical cancer
  Cervical carcinoma
  Congestive heart failure
  Epithelial ovarian cancer
  Head-neck squamous cell carcinoma
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Lupus
  Melanoma
  Non-insulin dependent diabetes
  Obesity
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Rheumatoid arthritis
  Schizophrenia
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Type-1/2 diabetes
  Clear cell renal carcinoma
  Colorectal carcinoma
  Liver cancer
  Muscular dystrophy
  Renal cell carcinoma
  Asthma
  Atopic dermatitis
  Colon cancer
  Colon carcinoma
• UniProt ID: ANXA6_HUMAN
• PDB ID: 1M9I
• Pfam ID: PF00191
• Sequence:
  MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQ
  SYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILA
  SRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQD
  VQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEK
  LMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKS
  LYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGTVRPA
  NDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE
  ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKED
  YHKSLEDALSSDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK
  TSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNK
  PLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGD
  FLKALLALCGGED
• Function: May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.
• Reactome Pathway: Smooth Muscle Contraction (R-HSA-445355)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Definitive	Altered Expression	[1]
Osteosarcoma	DISLQ7E2	Definitive	Altered Expression	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Autoimmune disease	DISORMTM	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[7]
Cardiac failure	DISDC067	Strong	Altered Expression	[8]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[9]
Cervical cancer	DISFSHPF	Strong	Biomarker	[10]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[10]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[11]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[12]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[15]
Lupus	DISOKJWA	Strong	Biomarker	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[18]
Obesity	DIS47Y1K	Strong	Altered Expression	[18]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[19]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[11]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[20]
Pancreatic cancer	DISJC981	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Altered Expression	[22]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[22]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[23]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[24]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[25]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[15]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[26]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[27]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[28]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[29]
Liver cancer	DISDE4BI	moderate	Biomarker	[30]
Muscular dystrophy	DISJD6P7	moderate	Biomarker	[31]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[28]
Asthma	DISW9QNS	Limited	Biomarker	[32]
Atopic dermatitis	DISTCP41	Limited	Biomarker	[33]
Colon cancer	DISVC52G	Limited	Altered Expression	[34]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[34]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Annexin A6 (ANXA6).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Annexin A6 (ANXA6).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Annexin A6 (ANXA6).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Annexin A6 (ANXA6).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Annexin A6 (ANXA6).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Annexin A6 (ANXA6).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Annexin A6 (ANXA6).	[41]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Annexin A6 (ANXA6).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Annexin A6 (ANXA6).	[43]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Annexin A6 (ANXA6).	[44]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Annexin A6 (ANXA6).	[45]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Annexin A6 (ANXA6).	[46]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Annexin A6 (ANXA6).	[47]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Annexin A6 (ANXA6).	[48]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Annexin A6 (ANXA6).	[48]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Annexin A6 (ANXA6).	[49]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Annexin A6 (ANXA6).	[50]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Annexin A6 (ANXA6).	[52]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Annexin A6 (ANXA6).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Annexin A6 (ANXA6).	[54]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Annexin A6 (ANXA6).	[55]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Annexin A6 (ANXA6).	[51]

References

• [1] Src and ROCK Kinases Differentially Regulate Mineralization of Human Osteosarcoma Saos-2 Cells.Int J Mol Sci. 2019 Jun 12;20(12):2872. doi: 10.3390/ijms20122872.
• [2] Discovery of epigenetically silenced genes in acute myeloid leukemias.Leukemia. 2007 May;21(5):1026-34. doi: 10.1038/sj.leu.2404611. Epub 2007 Mar 1.
• [3] The role of DEAD-box RNA helicase p68 (DDX5) in the development and treatment of breast cancer.J Cell Physiol. 2019 May;234(5):5478-5487. doi: 10.1002/jcp.26912. Epub 2018 Nov 11.
• [4] Neurofibrillary degeneration in Alzheimer's disease: from molecular mechanisms to identification of drug targets.Curr Opin Psychiatry. 2008 Nov;21(6):555-61. doi: 10.1097/YCO.0b013e328314b78b.
• [5] Major autoantigenic sites of the (U1) small nuclear ribonucleoprotein-specific 68-kDa protein.Scand J Immunol. 1990 Aug;32(2):163-76. doi: 10.1111/j.1365-3083.1990.tb02906.x.
• [6] The Dual PI3K/mTOR Pathway Inhibitor GDC-0084 Achieves Antitumor Activity in PIK3CA-Mutant Breast Cancer Brain Metastases.Clin Cancer Res. 2019 Jun 1;25(11):3374-3383. doi: 10.1158/1078-0432.CCR-18-3049. Epub 2019 Feb 22.
• [7] Implication of calcium activated RasGRF2 in Annexin A6-mediated breast tumor cell growth and motility.Oncotarget. 2019 Jan 4;10(2):133-151. doi: 10.18632/oncotarget.26512. eCollection 2019 Jan 4.
• [8] Altered cardiac annexin mRNA and protein levels in the left ventricle of patients with end-stage heart failure.J Mol Cell Cardiol. 1998 Mar;30(3):443-51. doi: 10.1006/jmcc.1997.0608.
• [9] Inhibition of p70 ribosomal S6 kinase 1 (S6K1) by PF-4708671 decreased infarct size in early cerebral ischemia-reperfusion with decreased BBB permeability.Eur J Pharmacol. 2019 Jul 15;855:202-207. doi: 10.1016/j.ejphar.2019.05.010. Epub 2019 May 4.
• [10] p68 prompts the epithelial-mesenchymal transition in cervical cancer cells by transcriptionally activating the TGF-1 signaling pathway.Oncol Lett. 2018 Feb;15(2):2111-2116. doi: 10.3892/ol.2017.7552. Epub 2017 Dec 8.
• [11] Upregulated Expression of Calcium-Dependent Annexin A6: A Potential Biomarker of Ovarian Carcinoma.Proteomics Clin Appl. 2020 Mar;14(2):e1900078. doi: 10.1002/prca.201900078. Epub 2020 Jan 9.
• [12] Overexpression of p68 mRNA in head and neck squamous cell carcinoma cells.Anticancer Res. 2006 May-Jun;26(3A):1941-6.
• [13] Dendritic cell function during chronic hepatitis C virus and human immunodeficiency virus type 1 infection.Clin Vaccine Immunol. 2007 Sep;14(9):1127-37. doi: 10.1128/CVI.00141-07. Epub 2007 Jul 18.
• [14] Annexin A6 protein is downregulated in human hepatocellular carcinoma.Mol Cell Biochem. 2016 Jul;418(1-2):81-90. doi: 10.1007/s11010-016-2735-9. Epub 2016 Jun 23.
• [15] Expression of the mammalian target of rapamycin pathway markers in lung adenocarcinoma and squamous cell carcinoma.Pathobiology. 2012;79(2):84-93. doi: 10.1159/000334340. Epub 2012 Jan 27.
• [16] p70 lupus autoantigen binds the enhancer of the T-cell receptor beta-chain gene.Proc Natl Acad Sci U S A. 1993 Apr 1;90(7):2685-9. doi: 10.1073/pnas.90.7.2685.
• [17] Identification by differential display of annexin-VI, a gene differentially expressed during melanoma progression.Cancer Res. 1996 Sep 1;56(17):3855-8.
• [18] Annexin A6 is highly abundant in monocytes of obese and type 2 diabetic individuals and is downregulated by adiponectin in vitro.Exp Mol Med. 2009 Jul 31;41(7):501-7. doi: 10.3858/emm.2009.41.7.055.
• [19] Inhibition of somatosensory mechanotransduction by annexin A6.Sci Signal. 2018 Jun 19;11(535):eaao2060. doi: 10.1126/scisignal.aao2060.
• [20] A novel p70 S6 kinase-microRNA biogenesis axis mediates multicellular spheroid formation in ovarian cancer progression.Oncotarget. 2016 Jun 21;7(25):38064-38077. doi: 10.18632/oncotarget.9345.
• [21] A novel inhibitory anti-invasive MAb isolated using phenotypic screening highlights AnxA6 as a functionally relevant target protein in pancreatic cancer.Br J Cancer. 2017 Oct 24;117(9):1326-1335. doi: 10.1038/bjc.2017.306. Epub 2017 Sep 7.
• [22] SGK3 is an androgen-inducible kinase promoting prostate cancer cell proliferation through activation of p70 S6 kinase and up-regulation of cyclin D1.Mol Endocrinol. 2014 Jun;28(6):935-48. doi: 10.1210/me.2013-1339. Epub 2014 Apr 16.
• [23] Genome-wide comparative analysis of atopic dermatitis and psoriasis gives insight into opposing genetic mechanisms.Am J Hum Genet. 2015 Jan 8;96(1):104-20. doi: 10.1016/j.ajhg.2014.12.004.
• [24] IL-12B Gene Polymorphisms and IL-12 p70 Serum Levels Among Patients with Rheumatoid Arthritis.Scand J Immunol. 2017 Feb;85(2):147-154. doi: 10.1111/sji.12514.
• [25] Altered subcellular localization of fragile X mental retardation signaling partners and targets in superior frontal cortex of individuals with schizophrenia.Neuroreport. 2017 Nov 8;28(16):1066-1070. doi: 10.1097/WNR.0000000000000880.
• [26] Gene-based meta-analysis of genome-wide association study data identifies independent single-nucleotide polymorphisms in ANXA6 as being associated with systemic lupus erythematosus in Asian populations.Arthritis Rheumatol. 2015 Nov;67(11):2966-77. doi: 10.1002/art.39275.
• [27] Nicotinate-curcumin ameliorates cognitive impairment in diabetic rats by rescuing autophagic flux in CA1 hippocampus.CNS Neurosci Ther. 2019 Apr;25(4):430-441. doi: 10.1111/cns.13059. Epub 2018 Sep 9.
• [28] Potential biomarkers for the therapeutic efficacy of sorafenib, sunitinib and everolimus.Oncol Rep. 2017 Jan;37(1):227-234. doi: 10.3892/or.2016.5232. Epub 2016 Nov 8.
• [29] Proteins in stool as biomarkers for non-invasive detection of colorectal adenomas with high risk of progression.J Pathol. 2020 Mar;250(3):288-298. doi: 10.1002/path.5369. Epub 2020 Jan 13.
• [30] Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.J Biol Chem. 2013 Nov 22;288(47):33667-33681. doi: 10.1074/jbc.M113.503292. Epub 2013 Oct 2.
• [31] Recombinant annexin A6 promotes membrane repair and protects against muscle injury.J Clin Invest. 2019 Nov 1;129(11):4657-4670. doi: 10.1172/JCI128840.
• [32] p70 Ribosomal S6 kinase is required for airway smooth muscle cell size enlargement but not increased contractile protein expression.Am J Respir Cell Mol Biol. 2010 Jun;42(6):744-52. doi: 10.1165/rcmb.2009-0037OC. Epub 2009 Jul 31.
• [33] Red ginseng extracts attenuate skin inflammation in atopic dermatitis through p70 ribosomal protein S6 kinase activation.J Pharmacol Sci. 2018 Jan;136(1):9-15. doi: 10.1016/j.jphs.2017.11.002. Epub 2017 Nov 10.
• [34] The DEAD box protein p68: a novel coactivator of Stat3 in mediating oncogenesis.Oncogene. 2017 Jun 1;36(22):3080-3093. doi: 10.1038/onc.2016.449. Epub 2016 Dec 12.
• [35] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [36] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [37] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [44] Proteomic analysis of hepatic effects of phenobarbital in mice with humanized liver. Arch Toxicol. 2022 Oct;96(10):2739-2754. doi: 10.1007/s00204-022-03338-7. Epub 2022 Jul 26.
• [45] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [46] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [47] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [48] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [53] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [54] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [55] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.