Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAJ7ZHG)

DOT Name Grancalcin (GCA)
Gene Name GCA
Related Disease
Liver cirrhosis ( )
Alzheimer disease ( )
Arterial disorder ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Autoimmune disease ( )
Bacterial infection ( )
Blindness ( )
Carcinoma ( )
Cardiovascular disease ( )
Cerebellar ataxia ( )
Colorectal carcinoma ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Cytomegalovirus infection ( )
Dementia ( )
Esophageal squamous cell carcinoma ( )
Essential hypertension ( )
Gerstmann-Straussler-Scheinker syndrome ( )
Hepatic encephalopathy ( )
Hepatitis B virus infection ( )
Hepatocellular carcinoma ( )
High blood pressure ( )
Leber hereditary optic neuropathy ( )
Matthew-Wood syndrome ( )
Mental disorder ( )
Myocardial infarction ( )
Myopia ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Obesity ( )
Peripheral vascular disease ( )
Stroke ( )
Type-1/2 diabetes ( )
Vasculitis ( )
Venous thromboembolism ( )
Krabbe disease ( )
Advanced cancer ( )
Anca-associated vasculitis ( )
Microscopic polyangiitis ( )
Neoplasm ( )
Neuroblastoma ( )
Polyarteritis nodosa ( )
Vascular disease ( )
UniProt ID
GRAN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1F4O; 1F4Q; 1K94; 1K95
Pfam ID
PF13202 ; PF13833
Sequence
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSA
VAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAA
LNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA
CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Function Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions.
Tissue Specificity Detected in neutrophils and macrophages (at protein level). Highly expressed in bone marrow.
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Liver cirrhosis DIS4G1GX Definitive Genetic Variation [1]
Alzheimer disease DISF8S70 Strong Genetic Variation [2]
Arterial disorder DISLG4XS Strong Biomarker [3]
Arteriosclerosis DISK5QGC Strong Biomarker [4]
Atherosclerosis DISMN9J3 Strong Biomarker [4]
Autoimmune disease DISORMTM Strong Biomarker [5]
Bacterial infection DIS5QJ9S Strong Altered Expression [6]
Blindness DISTIM10 Strong Biomarker [7]
Carcinoma DISH9F1N Strong Biomarker [8]
Cardiovascular disease DIS2IQDX Strong Biomarker [9]
Cerebellar ataxia DIS9IRAV Strong Genetic Variation [10]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [11]
Coronary atherosclerosis DISKNDYU Strong Biomarker [12]
Coronary heart disease DIS5OIP1 Strong Biomarker [12]
Cytomegalovirus infection DISCEMGC Strong Genetic Variation [13]
Dementia DISXL1WY Strong Genetic Variation [10]
Esophageal squamous cell carcinoma DIS5N2GV Strong Genetic Variation [14]
Essential hypertension DIS7WI98 Strong Biomarker [15]
Gerstmann-Straussler-Scheinker syndrome DISIO6KC Strong Biomarker [16]
Hepatic encephalopathy DISEAKAN Strong Genetic Variation [17]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [18]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [18]
High blood pressure DISY2OHH Strong Biomarker [9]
Leber hereditary optic neuropathy DIS7Y2EE Strong Biomarker [19]
Matthew-Wood syndrome DISA7HR7 Strong Altered Expression [20]
Mental disorder DIS3J5R8 Strong Genetic Variation [21]
Myocardial infarction DIS655KI Strong Biomarker [22]
Myopia DISK5S60 Strong Genetic Variation [23]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [24]
Non-small-cell lung cancer DIS5Y6R9 Strong Genetic Variation [25]
Obesity DIS47Y1K Strong Genetic Variation [26]
Peripheral vascular disease DISXSU1Y Strong Biomarker [22]
Stroke DISX6UHX Strong Biomarker [22]
Type-1/2 diabetes DISIUHAP Strong Genetic Variation [9]
Vasculitis DISQRKDX Strong Biomarker [27]
Venous thromboembolism DISUR7CR Strong Biomarker [22]
Krabbe disease DIS6H1IB moderate Biomarker [28]
Advanced cancer DISAT1Z9 Limited Biomarker [22]
Anca-associated vasculitis DISU3CNU Limited Genetic Variation [29]
Microscopic polyangiitis DIS74KSO Limited Genetic Variation [29]
Neoplasm DISZKGEW Limited Biomarker [30]
Neuroblastoma DISVZBI4 Limited Biomarker [31]
Polyarteritis nodosa DISRQ5X8 Limited Genetic Variation [29]
Vascular disease DISVS67S Limited Biomarker [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Topotecan DMP6G8T Approved Grancalcin (GCA) affects the response to substance of Topotecan. [48]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Grancalcin (GCA). [33]
------------------------------------------------------------------------------------
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Grancalcin (GCA). [34]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Grancalcin (GCA). [35]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Grancalcin (GCA). [36]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Grancalcin (GCA). [37]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Grancalcin (GCA). [38]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Grancalcin (GCA). [39]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Grancalcin (GCA). [40]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Grancalcin (GCA). [41]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Grancalcin (GCA). [42]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Grancalcin (GCA). [43]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Grancalcin (GCA). [44]
Isoflavone DM7U58J Phase 4 Isoflavone increases the expression of Grancalcin (GCA). [45]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Grancalcin (GCA). [39]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Grancalcin (GCA). [35]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Grancalcin (GCA). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Grancalcin (GCA). [46]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Grancalcin (GCA). [47]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)

References

1 The association between PIN1 genetic polymorphisms and the risk of chronic hepatitis B and hepatitis B virus-related liver cirrhosis: A case-control study.Medicine (Baltimore). 2018 Aug;97(35):e12123. doi: 10.1097/MD.0000000000012123.
2 Distinct subtypes of Alzheimer's disease based on patterns of brain atrophy: longitudinal trajectories and clinical applications.Sci Rep. 2017 Apr 18;7:46263. doi: 10.1038/srep46263.
3 Pathogenic mechanisms in giant cell arteritis.Cleve Clin J Med. 2002;69 Suppl 2:SII28-32. doi: 10.3949/ccjm.69.suppl_2.sii28.
4 Why do temporal arteries go wrong? Principles and pearls from a clinician and a pathologist.Rheumatology (Oxford). 2018 Feb 1;57(suppl_2):ii3-ii10. doi: 10.1093/rheumatology/kex524.
5 IFIH1-GCA-KCNH7 locus: influence on multiple sclerosis risk.Eur J Hum Genet. 2008 Jul;16(7):861-4. doi: 10.1038/ejhg.2008.16. Epub 2008 Feb 20.
6 Characterization of murine grancalcin specifically expressed in leukocytes and its possible role in host defense against bacterial infection.Biosci Biotechnol Biochem. 2004 Apr;68(4):894-902. doi: 10.1271/bbb.68.894.
7 Diagnosis and management of giant cell arteritis: an Asia-Pacific perspective.Int J Rheum Dis. 2019 Jan;22 Suppl 1:28-40. doi: 10.1111/1756-185X.13297. Epub 2018 Apr 17.
8 Mutation analysis of replicative genes encoding the large subunits of DNA polymerase alpha and replication factors A and C in human sporadic colorectal cancers.Int J Cancer. 2000 May 1;86(3):318-24. doi: 10.1002/(sici)1097-0215(20000501)86:3<318::aid-ijc3>3.0.co;2-b.
9 Mortality causes and trends associated with giant cell arteritis: analysis of the French national death certificate database (1980-2011).Rheumatology (Oxford). 2018 Jun 1;57(6):1047-1055. doi: 10.1093/rheumatology/key028.
10 Prion disease (PrP-A117V) presenting with ataxia instead of dementia.Neurology. 1995 Nov;45(11):2042-50. doi: 10.1212/wnl.45.11.2042.
11 Single-nucleotide polymorphisms in the vascular endothelial growth factor pathway and outcomes of patients treated with first-line cytotoxic chemotherapy combined with bevacizumab for advanced colorectal cancer.Oncology. 2014;87(5):280-92. doi: 10.1159/000365593. Epub 2014 Aug 15.
12 Polymorphism in glutamate-cysteine ligase modifier subunit gene is associated with impairment of nitric oxide-mediated coronary vasomotor function. Circulation. 2003 Sep 23;108(12):1425-7. doi: 10.1161/01.CIR.0000091255.63645.98. Epub 2003 Sep 15.
13 TLR9 2848 GA heterozygotic status possibly predisposes fetuses and newborns to congenital infection with human cytomegalovirus.PLoS One. 2015 Apr 6;10(4):e0122831. doi: 10.1371/journal.pone.0122831. eCollection 2015.
14 Genome-wide association study of esophageal squamous cell carcinoma in Chinese subjects identifies susceptibility loci at PLCE1 and C20orf54.Nat Genet. 2010 Sep;42(9):759-63. doi: 10.1038/ng.648. Epub 2010 Aug 22.
15 Association of TSC gene variants and hypertension in Mongolian and Han populations.Genet Mol Res. 2011 May 17;10(2):902-9. doi: 10.4238/vol10-2gmr1227.
16 Polymorphism at the mucin-like protocadherin gene influences susceptibility to gallstone disease.Clin Chim Acta. 2011 Nov 20;412(23-24):2089-93. doi: 10.1016/j.cca.2011.07.015. Epub 2011 Aug 1.
17 Validation study associating glutaminase promoter variations with hepatic encephalopathy in East Asian populations.J Gastroenterol Hepatol. 2017 Apr;32(4):901-907. doi: 10.1111/jgh.13618.
18 PIN1 genetic polymorphisms and the susceptibility of HBV-related hepatocellular carcinoma in a Guangxi population.Tumour Biol. 2016 May;37(5):6599-606. doi: 10.1007/s13277-015-4539-z. Epub 2015 Dec 7.
19 Macular Retinal Sublayer Thicknesses in G11778A Leber Hereditary Optic Neuropathy.Ophthalmic Surg Lasers Imaging Retina. 2016 Sep 1;47(9):802-10. doi: 10.3928/23258160-20160901-02.
20 Serum miR-16 as a potential biomarker for human cancer diagnosis: results from a large-scale population.J Cancer Res Clin Oncol. 2019 Mar;145(3):787-796. doi: 10.1007/s00432-019-02849-8. Epub 2019 Jan 31.
21 Glutamate cysteine ligase (GCL) and self reported depression: an association study from the HUNT.J Affect Disord. 2011 Jun;131(1-3):207-13. doi: 10.1016/j.jad.2010.12.019. Epub 2011 Jan 31.
22 Giant cell arteritis and vascular disease-risk factors and outcomes: a cohort study using UK Clinical Practice Research Datalink.Rheumatology (Oxford). 2017 May 1;56(5):753-762. doi: 10.1093/rheumatology/kew482.
23 Increased Vertical Asymmetry of Macular Retinal Layers in Myopic Chinese Children.Curr Eye Res. 2019 Feb;44(2):225-235. doi: 10.1080/02713683.2018.1530360. Epub 2018 Oct 26.
24 Structure-function relationship in early diabetic retinopathy: a spatial correlation analysis with OCT and microperimetry.Eye (Lond). 2017 Jun;31(6):931-939. doi: 10.1038/eye.2017.27. Epub 2017 Mar 3.
25 Effect of polymorphisms in XPD on clinical outcomes of platinum-based chemotherapy for Chinese non-small cell lung cancer patients.PLoS One. 2012;7(3):e33200. doi: 10.1371/journal.pone.0033200. Epub 2012 Mar 29.
26 Association of FTO polymorphisms with obesity and obesity-related outcomes in Portuguese children.PLoS One. 2013;8(1):e54370. doi: 10.1371/journal.pone.0054370. Epub 2013 Jan 14.
27 Large-Vessel Dilatation in Giant Cell Arteritis: A Different Subset of Disease?.Arthritis Care Res (Hoboken). 2018 Sep;70(9):1406-1411. doi: 10.1002/acr.23498. Epub 2018 Aug 12.
28 Rosmarinic acid counteracts activation of hepatic stellate cells via inhibiting the ROS-dependent MMP-2 activity: Involvement of Nrf2 antioxidant system.Toxicol Appl Pharmacol. 2017 Mar 1;318:69-78. doi: 10.1016/j.taap.2017.01.008. Epub 2017 Jan 20.
29 Are the 1990 American College of Rheumatology vasculitis classification criteria still valid?.Rheumatology (Oxford). 2017 Jul 1;56(7):1154-1161. doi: 10.1093/rheumatology/kex075.
30 Gene-expression profiling of the response of peripheral blood mononuclear cells and melanoma metastases to systemic IL-2 administration.Genome Biol. 2002 Jun 25;3(7):RESEARCH0035. doi: 10.1186/gb-2002-3-7-research0035. Epub 2002 Jun 25.
31 Human neuroblastoma cells with MYCN amplification are selectively resistant to oxidative stress by transcriptionally up-regulating glutamate cysteine ligase.J Neurochem. 2010 May;113(4):819-25. doi: 10.1111/j.1471-4159.2010.06648.x. Epub 2010 Feb 17.
32 Cardiovascular risk factors associated with polymyalgia rheumatica and giant cell arteritis in a prospective cohort: EPIC-Norfolk Study.Rheumatology (Oxford). 2020 Feb 1;59(2):319-323. doi: 10.1093/rheumatology/kez289.
33 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
34 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
35 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
36 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
37 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
38 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
39 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
40 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
41 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
42 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
43 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
44 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
45 Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
46 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
47 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
48 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.