Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBFN705)

DOT Name GRB2-associated-binding protein 2 (GAB2)
Synonyms GRB2-associated binder 2; Growth factor receptor bound protein 2-associated protein 2; pp100
Gene Name GAB2
Related Disease
Autoimmune disease ( )
Tuberculosis ( )
B-cell neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Childhood acute lymphoblastic leukemia ( )
Chronic obstructive pulmonary disease ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epilepsy ( )
Epithelial ovarian cancer ( )
Fatty liver disease ( )
Immunodeficiency ( )
leukaemia ( )
Leukemia ( )
Lung cancer ( )
Lung carcinoma ( )
Melanoma ( )
Myelodysplastic syndrome ( )
Non-small-cell lung cancer ( )
Obesity ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Plasma cell myeloma ( )
Pulmonary fibrosis ( )
Temporal lobe epilepsy ( )
Testicular germ cell tumor ( )
Uveal Melanoma ( )
Adult glioblastoma ( )
Clear cell renal carcinoma ( )
Glioblastoma multiforme ( )
Glioma ( )
Renal cell carcinoma ( )
Bone osteosarcoma ( )
Osteosarcoma ( )
Psychotic disorder ( )
Acute myelogenous leukaemia ( )
Ductal breast carcinoma in situ ( )
Hepatocellular carcinoma ( )
Lung squamous cell carcinoma ( )
Matthew-Wood syndrome ( )
Neuroblastoma ( )
Pancreatic ductal carcinoma ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
UniProt ID
GAB2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2VWF; 2W0Z; 5EWZ; 5EXA; 6Y3R; 6Y3S; 6ZVB; 6ZVC; 6ZVD; 6ZVE
Pfam ID
PF00169
Sequence
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL
Function
Adapter protein which acts downstream of several membrane receptors including cytokine, antigen, hormone, cell matrix and growth factor receptors to regulate multiple signaling pathways. Regulates osteoclast differentiation mediating the TNFRSF11A/RANK signaling. In allergic response, it plays a role in mast cells activation and degranulation through PI-3-kinase regulation. Also involved in the regulation of cell proliferation and hematopoiesis.
KEGG Pathway
Ras sig.ling pathway (hsa04014 )
Sphingolipid sig.ling pathway (hsa04071 )
Phospholipase D sig.ling pathway (hsa04072 )
Osteoclast differentiation (hsa04380 )
Fc epsilon RI sig.ling pathway (hsa04664 )
Fc gamma R-mediated phagocytosis (hsa04666 )
Chronic myeloid leukemia (hsa05220 )
Reactome Pathway
PIP3 activates AKT signaling (R-HSA-1257604 )
Signaling by SCF-KIT (R-HSA-1433557 )
Signaling by cytosolic FGFR1 fusion mutants (R-HSA-1839117 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Role of LAT2/NTAL/LAB on calcium mobilization (R-HSA-2730905 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
RET signaling (R-HSA-8853659 )
Interleukin-15 signaling (R-HSA-8983432 )
Interleukin receptor SHC signaling (R-HSA-912526 )
FLT3 Signaling (R-HSA-9607240 )
STAT5 Activation (R-HSA-9645135 )
Signaling by CSF3 (G-CSF) (R-HSA-9674555 )
Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 )
STAT5 activation downstream of FLT3 ITD mutants (R-HSA-9702518 )
Signaling by FLT3 fusion proteins (R-HSA-9703465 )
Signaling by FLT3 ITD and TKD mutants (R-HSA-9703648 )
PI3K Cascade (R-HSA-109704 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoimmune disease DISORMTM Definitive Biomarker [1]
Tuberculosis DIS2YIMD Definitive Biomarker [2]
B-cell neoplasm DISVY326 Strong Biomarker [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Breast neoplasm DISNGJLM Strong Biomarker [5]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Biomarker [6]
Chronic obstructive pulmonary disease DISQCIRF Strong Genetic Variation [7]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [8]
Colorectal neoplasm DISR1UCN Strong Altered Expression [9]
Endometrial cancer DISW0LMR Strong Altered Expression [10]
Endometrial carcinoma DISXR5CY Strong Altered Expression [10]
Epilepsy DISBB28L Strong Altered Expression [11]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [12]
Fatty liver disease DIS485QZ Strong Biomarker [13]
Immunodeficiency DIS093I0 Strong Biomarker [14]
leukaemia DISS7D1V Strong Genetic Variation [15]
Leukemia DISNAKFL Strong Genetic Variation [15]
Lung cancer DISCM4YA Strong Altered Expression [16]
Lung carcinoma DISTR26C Strong Altered Expression [16]
Melanoma DIS1RRCY Strong Genetic Variation [17]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [18]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [19]
Obesity DIS47Y1K Strong Biomarker [13]
Ovarian cancer DISZJHAP Strong Biomarker [12]
Ovarian neoplasm DISEAFTY Strong Biomarker [12]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [20]
Pulmonary fibrosis DISQKVLA Strong Biomarker [21]
Temporal lobe epilepsy DISNOPXX Strong Altered Expression [11]
Testicular germ cell tumor DIS5RN24 Strong Genetic Variation [22]
Uveal Melanoma DISA7ZGL Strong Altered Expression [23]
Adult glioblastoma DISVP4LU moderate Biomarker [24]
Clear cell renal carcinoma DISBXRFJ moderate Altered Expression [25]
Glioblastoma multiforme DISK8246 moderate Biomarker [24]
Glioma DIS5RPEH moderate Biomarker [26]
Renal cell carcinoma DISQZ2X8 moderate Altered Expression [25]
Bone osteosarcoma DIST1004 Disputed Altered Expression [27]
Osteosarcoma DISLQ7E2 Disputed Altered Expression [27]
Psychotic disorder DIS4UQOT Disputed Biomarker [28]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [29]
Ductal breast carcinoma in situ DISLCJY7 Limited Altered Expression [30]
Hepatocellular carcinoma DIS0J828 Limited Altered Expression [31]
Lung squamous cell carcinoma DISXPIBD Limited Biomarker [32]
Matthew-Wood syndrome DISA7HR7 Limited Biomarker [33]
Neuroblastoma DISVZBI4 Limited Altered Expression [34]
Pancreatic ductal carcinoma DIS26F9Q Limited Biomarker [33]
Rheumatoid arthritis DISTSB4J Limited Altered Expression [35]
Squamous cell carcinoma DISQVIFL Limited Biomarker [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of GRB2-associated-binding protein 2 (GAB2). [36]
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of GRB2-associated-binding protein 2 (GAB2). [43]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of GRB2-associated-binding protein 2 (GAB2). [43]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of GRB2-associated-binding protein 2 (GAB2). [54]
------------------------------------------------------------------------------------
19 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of GRB2-associated-binding protein 2 (GAB2). [37]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of GRB2-associated-binding protein 2 (GAB2). [38]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of GRB2-associated-binding protein 2 (GAB2). [39]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of GRB2-associated-binding protein 2 (GAB2). [40]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of GRB2-associated-binding protein 2 (GAB2). [41]
Estradiol DMUNTE3 Approved Estradiol increases the expression of GRB2-associated-binding protein 2 (GAB2). [42]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of GRB2-associated-binding protein 2 (GAB2). [44]
Triclosan DMZUR4N Approved Triclosan decreases the expression of GRB2-associated-binding protein 2 (GAB2). [45]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of GRB2-associated-binding protein 2 (GAB2). [46]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of GRB2-associated-binding protein 2 (GAB2). [47]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of GRB2-associated-binding protein 2 (GAB2). [48]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of GRB2-associated-binding protein 2 (GAB2). [46]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of GRB2-associated-binding protein 2 (GAB2). [49]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of GRB2-associated-binding protein 2 (GAB2). [50]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of GRB2-associated-binding protein 2 (GAB2). [51]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of GRB2-associated-binding protein 2 (GAB2). [52]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of GRB2-associated-binding protein 2 (GAB2). [53]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of GRB2-associated-binding protein 2 (GAB2). [55]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of GRB2-associated-binding protein 2 (GAB2). [56]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Drug(s)

References

1 Age-related gene expression changes, and transcriptome wide association study of physical and cognitive aging traits, in the Lothian Birth Cohort 1936.Aging (Albany NY). 2017 Dec 1;9(12):2489-2503. doi: 10.18632/aging.101333.
2 Growth factor receptor bound protein 2-associated binder 2, a scaffolding adaptor protein, negatively regulates host immunity against tuberculosis.Am J Respir Cell Mol Biol. 2014 Oct;51(4):575-85. doi: 10.1165/rcmb.2013-0329OC.
3 Gab2 mediates hepatocellular carcinogenesis by integrating multiple signaling pathways.FASEB J. 2017 Dec;31(12):5530-5542. doi: 10.1096/fj.201700120RR. Epub 2017 Aug 21.
4 MiR-98-5p regulates proliferation and metastasis of MCF-7 breast cancer cells by targeting Gab2.Eur Rev Med Pharmacol Sci. 2019 Apr;23(7):2847-2855. doi: 10.26355/eurrev_201904_17562.
5 A role for the scaffolding adapter GAB2 in breast cancer.Nat Med. 2006 Jan;12(1):114-21. doi: 10.1038/nm1341. Epub 2005 Dec 20.
6 Predisposing germline mutations in high hyperdiploid acute lymphoblastic leukemia in children.Genes Chromosomes Cancer. 2019 Oct;58(10):723-730. doi: 10.1002/gcc.22765. Epub 2019 May 27.
7 Genetic overlap of chronic obstructive pulmonary disease and cardiovascular disease-related traits: a large-scale genome-wide cross-trait analysis.Respir Res. 2019 Apr 2;20(1):64. doi: 10.1186/s12931-019-1036-8.
8 MicroRNA-485 plays tumour-suppressive roles in colorectal cancer by directly targeting GAB2.Oncol Rep. 2018 Jul;40(1):554-564. doi: 10.3892/or.2018.6449. Epub 2018 May 17.
9 Clinical significance of GAB2, a scaffolding/docking protein acting downstream of EGFR in human colorectal cancer.Ann Surg Oncol. 2014 Dec;21 Suppl 4:S743-9. doi: 10.1245/s10434-014-3889-x. Epub 2014 Jul 17.
10 YAP/TAZ-Mediated Upregulation of GAB2 Leads to Increased Sensitivity to Growth Factor-Induced Activation of the PI3K Pathway.Cancer Res. 2017 Apr 1;77(7):1637-1648. doi: 10.1158/0008-5472.CAN-15-3084. Epub 2017 Feb 15.
11 Decreased expression of Gab2 in patients with temporal lobe epilepsy and pilocarpine-induced rat model.Synapse. 2014 Apr;68(4):168-77. doi: 10.1002/syn.21725. Epub 2013 Dec 20.
12 Synergistic effects of SHP2 and PI3K pathway inhibitors in GAB2-overexpressing ovarian cancer.Am J Cancer Res. 2019 Jan 1;9(1):145-159. eCollection 2019.
13 Deletion of Gab2 in mice protects against hepatic steatosis and steatohepatitis: a novel therapeutic target for fatty liver disease.J Mol Cell Biol. 2016 Dec;8(6):492-504. doi: 10.1093/jmcb/mjw028. Epub 2016 Jun 9.
14 Overexpression of GAB2 in ovarian cancer cells promotes tumor growth and angiogenesis by upregulating chemokine expression.Oncogene. 2016 Aug 4;35(31):4036-47. doi: 10.1038/onc.2015.472. Epub 2015 Dec 14.
15 Inhibition of the Gab2/PI3K/mTOR signaling ameliorates myeloid malignancy caused by Ptpn11 (Shp2) gain-of-function mutations.Leukemia. 2017 Jun;31(6):1415-1422. doi: 10.1038/leu.2016.326. Epub 2016 Nov 14.
16 Docking protein Gab2 regulates mucin expression and goblet cell hyperplasia through TYK2/STAT6 pathway.FASEB J. 2012 Nov;26(11):4603-13. doi: 10.1096/fj.12-211755. Epub 2012 Aug 2.
17 GAB2 induces tumor angiogenesis in NRAS-driven melanoma.Oncogene. 2013 Aug 1;32(31):3627-37. doi: 10.1038/onc.2012.367. Epub 2012 Aug 27.
18 GAB2 is a novel target of 11q amplification in AML/MDS.Genes Chromosomes Cancer. 2006 Sep;45(9):798-807. doi: 10.1002/gcc.20344.
19 miR-486-5p inhibits cell proliferation and invasion through repressing GAB2 in non-small cell lung cancer.Oncol Lett. 2018 Sep;16(3):3525-3530. doi: 10.3892/ol.2018.9053. Epub 2018 Jun 29.
20 Critical role for hematopoietic cell kinase (Hck)-mediated phosphorylation of Gab1 and Gab2 docking proteins in interleukin 6-induced proliferation and survival of multiple myeloma cells.J Biol Chem. 2004 May 14;279(20):21658-65. doi: 10.1074/jbc.M305783200. Epub 2004 Mar 9.
21 Increased levels of Gab1 and Gab2 adaptor proteins skew interleukin-4 (IL-4) signaling toward M2 macrophage-driven pulmonary fibrosis in mice.J Biol Chem. 2017 Aug 25;292(34):14003-14015. doi: 10.1074/jbc.M117.802066. Epub 2017 Jul 7.
22 Identification of four new susceptibility loci for testicular germ cell tumour.Nat Commun. 2015 Oct 27;6:8690. doi: 10.1038/ncomms9690.
23 Grb2-associated binder 2 expression and its roles in uveal melanoma invasion.Mol Med Rep. 2017 Oct;16(4):4577-4582. doi: 10.3892/mmr.2017.7151. Epub 2017 Aug 3.
24 MicroRNA-197 inhibits cell proliferation by targeting GAB2 in glioblastoma.Mol Med Rep. 2016 May;13(5):4279-88. doi: 10.3892/mmr.2016.5076. Epub 2016 Mar 31.
25 microRNA-302c-3p inhibits renal cell carcinoma cell proliferation by targeting Grb2-associated binding 2 (Gab2).Oncotarget. 2017 Apr 18;8(16):26334-26343. doi: 10.18632/oncotarget.15463.
26 MicroRNA-302a targets GAB2 to suppress cell proliferation, migration and invasion of glioma.Oncol Rep. 2017 Feb;37(2):1159-1167. doi: 10.3892/or.2016.5320. Epub 2016 Dec 15.
27 Effects of Grb2-associated binding protein 2-specific siRNA on the migration and invasion of MG-63 osteosarcoma cells.Oncol Lett. 2018 Jan;15(1):926-930. doi: 10.3892/ol.2017.7375. Epub 2017 Nov 9.
28 Circuit activity underlying a distinct modulator of prepulse inhibition.Psychiatry Res Neuroimaging. 2019 Jun 30;288:1-11. doi: 10.1016/j.pscychresns.2019.04.005. Epub 2019 Apr 19.
29 Gab2 is involved in differential phosphoinositide 3-kinase signaling by two splice forms of c-Kit.J Biol Chem. 2008 Oct 10;283(41):27444-27451. doi: 10.1074/jbc.M709703200. Epub 2008 Aug 11.
30 Overexpression of the oncogenic signal transducer Gab2 occurs early in breast cancer development.Int J Cancer. 2010 Sep 1;127(6):1486-92. doi: 10.1002/ijc.25172.
31 MicroRNA?63b targets GAB2 to restrict cell proliferation and invasion in hepatocellular carcinoma.Mol Med Rep. 2019 Apr;19(4):2913-2920. doi: 10.3892/mmr.2019.9934. Epub 2019 Feb 5.
32 GAB2 Amplification in Squamous Cell Lung Cancer of Non-Smokers.J Korean Med Sci. 2017 Nov;32(11):1784-1791. doi: 10.3346/jkms.2017.32.11.1784.
33 Expression of signaling adaptor proteins predicts poor prognosis in pancreatic ductal adenocarcinoma.Diagn Pathol. 2017 May 30;12(1):42. doi: 10.1186/s13000-017-0633-4.
34 Critical Role for GAB2 in Neuroblastoma Pathogenesis through the Promotion of SHP2/MYCN Cooperation.Cell Rep. 2017 Mar 21;18(12):2932-2942. doi: 10.1016/j.celrep.2017.02.065.
35 Peripheral blood gene expression profiling in rheumatoid arthritis.Genes Immun. 2005 Aug;6(5):388-97. doi: 10.1038/sj.gene.6364209.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
38 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
39 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
40 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
41 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
42 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
43 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
44 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
45 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
46 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
47 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
48 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
49 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
50 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
51 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
52 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
53 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
54 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
55 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
56 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.