Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCA9ZF5)

• DOT Name: Ras-related protein Rab-40B (RAB40B)
• Synonyms: SOCS box-containing protein RAR; Protein Rar
• Gene Name: RAB40B
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Adenocarcinoma
  Bladder cancer
  Carcinoma
  Carcinoma of esophagus
  Colorectal carcinoma
  Depression
  Esophageal adenocarcinoma
  Esophageal cancer
  Fatty liver disease
  Gastric cancer
  Head-neck squamous cell carcinoma
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Hypothyroidism
  leukaemia
  Leukemia
  Lung carcinoma
  Multiple sclerosis
  Myelodysplastic syndrome
  Neoplasm of esophagus
  Promyelocytic leukaemia
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Squamous cell carcinoma
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Advanced cancer
  Alcohol dependence
  Attention deficit hyperactivity disorder
  Autism
  Bipolar disorder
  Bronchopulmonary dysplasia
  Cervical carcinoma
  Lung cancer
  Melanoma
  Rheumatoid arthritis
  Asthma
  Human papillomavirus infection
  Lymphoma
  Neuroblastoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Wilms tumor
• UniProt ID: RB40B_HUMAN
• Pfam ID: PF00071 ; PF07525
• Sequence:
  MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDG
  RRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVP
  KILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGM
  DRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGS
  YSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS
• Function: May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Reactome Pathway: RAB geranylgeranylation (R-HSA-8873719)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[4]
Bladder cancer	DISUHNM0	Strong	Posttranslational Modification	[5]
Carcinoma	DISH9F1N	Strong	Biomarker	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Depression	DIS3XJ69	Strong	Altered Expression	[9]
Esophageal adenocarcinoma	DISODWFP	Strong	Altered Expression	[10]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[7]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[11]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Posttranslational Modification	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Hypothyroidism	DISR0H6D	Strong	Altered Expression	[15]
leukaemia	DISS7D1V	Strong	Altered Expression	[16]
Leukemia	DISNAKFL	Strong	Altered Expression	[16]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[18]
Myelodysplastic syndrome	DISYHNUI	Strong	Genetic Variation	[19]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[7]
Promyelocytic leukaemia	DISYGG13	Strong	Genetic Variation	[20]
Prostate cancer	DISF190Y	Strong	Biomarker	[21]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[21]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[22]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[23]
Stomach cancer	DISKIJSX	Strong	Biomarker	[12]
Urinary bladder cancer	DISDV4T7	Strong	Posttranslational Modification	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Posttranslational Modification	[5]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[24]
Alcohol dependence	DIS4ZSCO	moderate	Genetic Variation	[25]
Attention deficit hyperactivity disorder	DISL8MX9	moderate	Genetic Variation	[25]
Autism	DISV4V1Z	moderate	Genetic Variation	[25]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[25]
Bronchopulmonary dysplasia	DISO0BY5	moderate	Genetic Variation	[25]
Cervical carcinoma	DIST4S00	moderate	Altered Expression	[26]
Lung cancer	DISCM4YA	moderate	Biomarker	[17]
Melanoma	DIS1RRCY	moderate	Posttranslational Modification	[27]
Rheumatoid arthritis	DISTSB4J	Disputed	Altered Expression	[28]
Asthma	DISW9QNS	Limited	Biomarker	[29]
Human papillomavirus infection	DISX61LX	Limited	Genetic Variation	[30]
Lymphoma	DISN6V4S	Limited	Genetic Variation	[31]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[32]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[33]
Thyroid tumor	DISLVKMD	Limited	Altered Expression	[33]
Wilms tumor	DISB6T16	Limited	Genetic Variation	[34]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Ras-related protein Rab-40B (RAB40B) affects the response to substance of Cisplatin.	[48]
Capecitabine	DMTS85L	Approved	Ras-related protein Rab-40B (RAB40B) increases the response to substance of Capecitabine.	[49]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ras-related protein Rab-40B (RAB40B).	[35]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Ras-related protein Rab-40B (RAB40B).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Ras-related protein Rab-40B (RAB40B).	[45]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ras-related protein Rab-40B (RAB40B).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ras-related protein Rab-40B (RAB40B).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ras-related protein Rab-40B (RAB40B).	[38]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ras-related protein Rab-40B (RAB40B).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Ras-related protein Rab-40B (RAB40B).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Ras-related protein Rab-40B (RAB40B).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Ras-related protein Rab-40B (RAB40B).	[42]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Ras-related protein Rab-40B (RAB40B).	[43]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ras-related protein Rab-40B (RAB40B).	[46]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Ras-related protein Rab-40B (RAB40B).	[47]

References

• [1] Parallel comparison of pre-conditioning and post-conditioning effects in human cancers and keratinocytes upon acute gamma irradiation.Int J Radiat Biol. 2019 Feb;95(2):170-178. doi: 10.1080/09553002.2019.1547850. Epub 2019 Jan 4.
• [2] Polyclonal hemopoiesis in leukemia patients following molecularly documented remission.Leukemia. 1994 Apr;8 Suppl 1:S137-9.
• [3] All-trans retinoic acid enhances, and a pan-RAR antagonist counteracts, the stem cell promoting activity of EVI1 in acute myeloid leukemia.Cell Death Dis. 2019 Dec 10;10(12):944. doi: 10.1038/s41419-019-2172-2.
• [4] Retinoic acid receptor-alpha messenger RNA expression is increased and retinoic acid receptor-gamma expression is decreased in Barrett's intestinal metaplasia, dysplasia, adenocarcinoma sequence.Surgery. 2001 Mar;129(3):267-76. doi: 10.1067/msy.2001.110856.
• [5] Urinary retinoic acid receptor-2 gene promoter methylation and hyaluronidase activity as noninvasive tests for diagnosis of bladder cancer.Clin Biochem. 2012 Apr;45(6):402-7. doi: 10.1016/j.clinbiochem.2012.01.010. Epub 2012 Jan 18.
• [6] Human thyroid carcinoma cell lines show different retinoic acid receptor repertoires and retinoid responses.Eur J Endocrinol. 2004 Apr;150(4):547-56. doi: 10.1530/eje.0.1500547.
• [7] Benzo[a]pyrene diol epoxide suppresses retinoic acid receptor-beta2 expression by recruiting DNA (cytosine-5-)-methyltransferase 3A.Mol Cancer. 2010 Apr 28;9:93. doi: 10.1186/1476-4598-9-93.
• [8] The anti-cancer effect of retinoic acid signaling in CRC occurs via decreased growth of ALDH+ colon cancer stem cells and increased differentiation of stem cells.Oncotarget. 2018 Oct 5;9(78):34658-34669. doi: 10.18632/oncotarget.26157. eCollection 2018 Oct 5.
• [9] Rest-activity rhythm and sleep characteristics associated with depression symptom severity in strained dementia caregivers.J Sleep Res. 2017 Dec;26(6):718-725. doi: 10.1111/jsr.12549. Epub 2017 May 10.
• [10] Inhibition of farnesoid X receptor controls esophageal cancer cell growth in vitro and in nude mouse xenografts.Cancer. 2013 Apr 1;119(7):1321-9. doi: 10.1002/cncr.27910. Epub 2012 Dec 20.
• [11] Expression of the peroxisome proliferator-activated receptor gene is decreased in experimental alcoholic liver disease.Life Sci. 1995;56(5):307-17. doi: 10.1016/0024-3205(94)00953-8.
• [12] Rab40b upregulation correlates with the prognosis of gastric cancer by promoting migration, invasion, and metastasis.Med Oncol. 2015 Apr;32(4):126. doi: 10.1007/s12032-015-0562-6. Epub 2015 Mar 20.
• [13] RAR beta2 suppression in head and neck squamous cell carcinoma correlates with site, histology and age.Oncol Rep. 2007 Jul;18(1):105-12.
• [14] Hepatitis C virus Core protein overcomes all-trans retinoic acid-induced cell growth arrest by inhibiting retinoic acid receptor-2 expression via DNA methylation.Cancer Lett. 2013 Jul 28;335(2):372-9. doi: 10.1016/j.canlet.2013.02.057. Epub 2013 Mar 6.
• [15] Expression of proteins related to thyroid hormone function in the uterus is down-regulated at the day of implantation in hypothyroid pregnant rats.Cell Biol Int. 2019 May;43(5):486-494. doi: 10.1002/cbin.11114. Epub 2019 Mar 12.
• [16] From oncogene to tumor suppressor: the dual role of Myc in leukemia.Cell Cycle. 2012 May 1;11(9):1757-64. doi: 10.4161/cc.19883. Epub 2012 May 1.
• [17] Signalling with retinoids in the human lung: validation of new tools for the expression study of retinoid receptors.BMC Cancer. 2009 Dec 4;9:423. doi: 10.1186/1471-2407-9-423.
• [18] Impact of vitamin A supplementation on RAR gene expression in multiple sclerosis patients.J Mol Neurosci. 2013 Oct;51(2):478-84. doi: 10.1007/s12031-013-0090-9. Epub 2013 Aug 17.
• [19] A prognostic model of therapy-related myelodysplastic syndrome for predicting survival and transformation to acute myeloid leukemia.Clin Lymphoma Myeloma Leuk. 2014 Oct;14(5):401-10. doi: 10.1016/j.clml.2014.03.001. Epub 2014 May 6.
• [20] The NPM-RAR fusion protein associated with the t(5;17) variant of APL does not interact with PML.Leuk Res. 2006 Aug;30(8):979-86. doi: 10.1016/j.leukres.2005.12.029. Epub 2006 Feb 28.
• [21] Interactive effects of 9-cis-retinoic acid and androgen on proliferation, differentiation, and apoptosis of LNCaP prostate cancer cells.Eur J Cancer Prev. 2017 Jan;26(1):71-77. doi: 10.1097/CEJ.0000000000000230.
• [22] Loss of the Epigenetic Mark 5-hmC in Psoriasis: Implications for Epidermal Stem Cell Dysregulation.J Invest Dermatol. 2020 Jun;140(6):1266-1275.e3. doi: 10.1016/j.jid.2019.10.016. Epub 2019 Dec 11.
• [23] Methylation and silencing of the retinoic acid receptor-beta 2 gene in cervical cancer.BMC Cancer. 2002 Mar 21;2:4. doi: 10.1186/1471-2407-2-4.
• [24] The molecular physiology of nuclear retinoic acid receptors. From health to disease.Biochim Biophys Acta. 2011 Aug;1812(8):1023-31. doi: 10.1016/j.bbadis.2010.10.007. Epub 2010 Oct 20.
• [25] Structural variants in the retinoid receptor genes in patients with schizophrenia and other psychiatric diseases.Am J Med Genet B Neuropsychiatr Genet. 2005 Feb 5;133B(1):50-3. doi: 10.1002/ajmg.b.30113.
• [26] The effect of all-trans and 9-cis retinoic acid on the steady state level of HPV16 E6/E7 mRNA and cell cycle in cervical carcinoma cells.Life Sci. 1998;63(7):565-73. doi: 10.1016/s0024-3205(98)00307-5.
• [27] Profiling epigenetic inactivation of tumor suppressor genes in tumors and plasma from cutaneous melanoma patients.Oncogene. 2004 May 13;23(22):4014-22. doi: 10.1038/sj.onc.1207505.
• [28] Lipopolysaccharide mediates hepatic stellate cell activation by regulating autophagy and retinoic acid signaling.Autophagy. 2017;13(11):1813-1827. doi: 10.1080/15548627.2017.1356550. Epub 2017 Nov 21.
• [29] Placentaderived mesenchymal stem cells improve airway hyperresponsiveness and inflammation in asthmatic rats by modulating the Th17/Treg balance.Mol Med Rep. 2017 Dec;16(6):8137-8145. doi: 10.3892/mmr.2017.7605. Epub 2017 Sep 25.
• [30] Population-based case-control study on DAPK1, RAR-2 and MGMT methylation in liquid-based cytology.Arch Gynecol Obstet. 2012 May;285(5):1433-9. doi: 10.1007/s00404-011-2149-6. Epub 2011 Nov 25.
• [31] The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion.Blood. 1996 Feb 1;87(3):882-6.
• [32] Expression of co-factors (SMRT and Trip-1) for retinoic acid receptors in human neuroectodermal cell lines.Biochem Biophys Res Commun. 1997 May 8;234(1):278-82. doi: 10.1006/bbrc.1997.6626.
• [33] mRNA expression pattern of retinoic acid and retinoid X nuclear receptor subtypes in human thyroid papillary carcinoma.Oncol Rep. 2013 Nov;30(5):2371-8. doi: 10.3892/or.2013.2670. Epub 2013 Aug 20.
• [34] Methylation profile of the promoter CpG islands of 31 genes that may contribute to colorectal carcinogenesis.World J Gastroenterol. 2004 Dec 1;10(23):3441-54. doi: 10.3748/wjg.v10.i23.3441.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [42] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [43] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [44] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [45] MEST mediates the impact of prenatal bisphenol A exposure on long-term body weight development. Clin Epigenetics. 2018 Apr 20;10:58. doi: 10.1186/s13148-018-0478-z. eCollection 2018.
• [46] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [47] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [48] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [49] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.