Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDNGWAF)

• DOT Name: Glutathione S-transferase kappa 1 (GSTK1)
• Synonyms: EC 2.5.1.18; GST 13-13; GST class-kappa; GSTK1-1; hGSTK1; Glutathione S-transferase subunit 13
• Gene Name: GSTK1
• Related Disease:
  Leukemia
  Lung neoplasm
  Acute leukaemia
  Acute lymphocytic leukaemia
  Bladder cancer
  Bone osteosarcoma
  Carcinoma
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Coronary heart disease
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Essential hypertension
  Head and neck cancer
  Head and neck carcinoma
  Hepatitis C virus infection
  Inflammatory bowel disease
  leukaemia
  Multiple sclerosis
  Myelodysplastic syndrome
  OPTN-related open angle glaucoma
  Osteoarthritis
  Osteosarcoma
  Prostate neoplasm
  Psoriasis
  Renal cell carcinoma
  Schizophrenia
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Type-1/2 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adenocarcinoma
  Brain neoplasm
  Male infertility
  Non-insulin dependent diabetes
  Tuberculosis
  Acute myelogenous leukaemia
  Cardiovascular disease
  Childhood acute lymphoblastic leukemia
  Clear cell renal carcinoma
  Colon carcinoma
  Endometriosis
  Head-neck squamous cell carcinoma
  Neuroblastoma
• UniProt ID: GSTK1_HUMAN
• PDB ID: 1YZX; 3RPN; 3RPP
• EC Number: 2.5.1.18
• Pfam ID: PF01323
• Sequence:
  MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
  RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
  LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
  FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
• Function: Glutathione S-transferase that catalyzes the conjugation of glutathione to exogenous and endogenous compounds. Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
• Tissue Specificity: Ubiquitous.
• KEGG Pathway:
  Glutathione metabolism (hsa00480)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Drug metabolism - cytochrome P450 (hsa00982)
  Metabolic pathways (hsa01100)
  Peroxisome (hsa04146)
  Chemical carcinogenesis - D. adducts (hsa05204)
• Reactome Pathway:
  Peroxisomal protein import (R-HSA-9033241)
  Glutathione conjugation (R-HSA-156590)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Leukemia	DISNAKFL	Definitive	Genetic Variation	[1]
Lung neoplasm	DISVARNB	Definitive	Altered Expression	[2]
Acute leukaemia	DISDQFDI	Strong	Genetic Variation	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[4]
Bladder cancer	DISUHNM0	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Biomarker	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[8]
Cervical cancer	DISFSHPF	Strong	Genetic Variation	[9]
Cervical carcinoma	DIST4S00	Strong	Genetic Variation	[9]
Colon cancer	DISVC52G	Strong	Biomarker	[10]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[11]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[13]
Essential hypertension	DIS7WI98	Strong	Genetic Variation	[14]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[15]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[15]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[16]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[17]
leukaemia	DISS7D1V	Strong	Genetic Variation	[1]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[18]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[19]
OPTN-related open angle glaucoma	DISDR98A	Strong	Genetic Variation	[20]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[22]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[24]
Schizophrenia	DISSRV2N	Strong	Biomarker	[25]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[26]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[28]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[5]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[29]
Brain neoplasm	DISY3EKS	moderate	Genetic Variation	[30]
Male infertility	DISY3YZZ	moderate	Genetic Variation	[31]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Genetic Variation	[32]
Tuberculosis	DIS2YIMD	moderate	Biomarker	[33]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[34]
Cardiovascular disease	DIS2IQDX	Limited	Genetic Variation	[35]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Limited	Genetic Variation	[4]
Clear cell renal carcinoma	DISBXRFJ	Limited	Genetic Variation	[24]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[10]
Endometriosis	DISX1AG8	Limited	Genetic Variation	[36]
Head-neck squamous cell carcinoma	DISF7P24	Limited	Altered Expression	[37]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[38]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Glutathione S-transferase kappa 1 (GSTK1).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[44]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[46]
Phenytoin	DMNOKBV	Approved	Phenytoin decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[47]
Beta-carotene	DM0RXBT	Approved	Beta-carotene decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[48]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[49]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[52]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[54]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[55]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Glutathione S-transferase kappa 1 (GSTK1).	[56]

References

• [1] Polymorphic variants of GSTM1, GSTT1, and GSTP1 genes in childhood acute leukemias: A preliminary study in Argentina.Hematology. 2015 Oct;20(9):511-6. doi: 10.1179/1607845415Y.0000000007. Epub 2015 Mar 23.
• [2] Epigenetic mechanisms for silencing glutathione S-transferase m2 expression by hypermethylated specificity protein 1 binding in lung cancer.Cancer. 2011 Jul 15;117(14):3209-21. doi: 10.1002/cncr.25875. Epub 2011 Jan 18.
• [3] Glutathione-S-transferase polymorphisms (GSTM1, GSTT1 and GSTP1) and acute leukemia risk in Asians: a meta-analysis.Asian Pac J Cancer Prev. 2014;15(5):2075-81. doi: 10.7314/apjcp.2014.15.5.2075.
• [4] Improving risk stratification of patients with childhood acute lymphoblastic leukemia: Glutathione-S-Transferases polymorphisms are associated with increased risk of relapse.Oncotarget. 2017 Jan 3;8(1):110-117. doi: 10.18632/oncotarget.8606.
• [5] Evaluation of NMP22 in bladder cancer patients sensitive to environmental toxins.Adv Clin Exp Med. 2017 Oct;26(7):1069-1075. doi: 10.17219/acem/63156.
• [6] PCAF regulates H3 phosphorylation and promotes autophagy in osteosarcoma cells.Biomed Pharmacother. 2019 Oct;118:109395. doi: 10.1016/j.biopha.2019.109395. Epub 2019 Aug 29.
• [7] Identification of epigenetically downregulated Tmem70 and Ube2e2 in rat liver after 28-day treatment with hepatocarcinogenic thioacetamide showing gene product downregulation in hepatocellular preneoplastic and neoplastic lesions produced by tumor promotion.Toxicol Lett. 2017 Jan 15;266:13-22. doi: 10.1016/j.toxlet.2016.11.022. Epub 2016 Nov 30.
• [8] Association of xenobiotic metabolizing enzymes genetic polymorphisms with esophageal cancer in Kashmir Valley and influence of environmental factors.Nutr Cancer. 2010;62(6):734-42. doi: 10.1080/01635581003605904.
• [9] Impact of GSTM1, GSTT1 and GSTP1 genes polymorphisms on clinical toxicities and response to concomitant chemoradiotherapy in cervical cancer.Br J Biomed Sci. 2018 Oct;75(4):169-174. doi: 10.1080/09674845.2018.1482734. Epub 2018 Aug 17.
• [10] Glutathione, an Antioxidant Tripeptide: Dual Roles in Carcinogenesis and Chemoprevention.Curr Protein Pept Sci. 2019;20(9):907-917. doi: 10.2174/1389203720666190206130003.
• [11] Glutathione Transferase P1 Polymorphism Might Be a Risk Determinant in Heart Failure.Dis Markers. 2019 Jun 2;2019:6984845. doi: 10.1155/2019/6984845. eCollection 2019.
• [12] Autophagy negatively regulates cancer cell proliferation via selectively targeting VPRBP.Clin Sci (Lond). 2013 Feb;124(3):203-14. doi: 10.1042/CS20120270.
• [13] No role for glutathione S-transferase genotypes in Caucasian esophageal squamous cell or adenocarcinoma etiology: an European case-control study.BMC Gastroenterol. 2013 Jun 3;13:97. doi: 10.1186/1471-230X-13-97.
• [14] Association of ACE, FABP2 and GST genes polymorphism with essential hypertension risk among a North Indian population.Ann Hum Biol. 2015;42(5):461-9. doi: 10.3109/03014460.2014.968206. Epub 2014 Oct 30.
• [15] Clinical Management of Head and Neck Cancer Cases: Role of Pharmacogenetics of CYP2 and GSTs.Oncol Res Treat. 2016;39(4):221-6. doi: 10.1159/000444608. Epub 2016 Feb 26.
• [16] Degradation of AIMP1/p43 induced by hepatitis C virus E2 leads to upregulation of TGF- signaling and increase in surface expression of gp96.PLoS One. 2014 May 9;9(5):e96302. doi: 10.1371/journal.pone.0096302. eCollection 2014.
• [17] Genetic Polymorphisms of Multidrug Resistance Gene-1 (MDR1/ABCB1) and Glutathione S-Transferase Gene and the Risk of Inflammatory Bowel Disease among Moroccan Patients.Mediators Inflamm. 2015;2015:248060. doi: 10.1155/2015/248060. Epub 2015 Oct 28.
• [18] Dysregulation of Mesenchymal Stromal Cell Antioxidant Responses in Progressive Multiple Sclerosis.Stem Cells Transl Med. 2018 Oct;7(10):748-758. doi: 10.1002/sctm.18-0045. Epub 2018 Jul 31.
• [19] Applying a Weight-of-Evidence Approach to Evaluate Relevance of Molecular Landscapes in the Exposure-Disease Paradigm.Biomed Res Int. 2015;2015:515798. doi: 10.1155/2015/515798. Epub 2015 Aug 3.
• [20] Association of glutathione S transferases polymorphisms with glaucoma: a meta-analysis.PLoS One. 2013;8(1):e54037. doi: 10.1371/journal.pone.0054037. Epub 2013 Jan 14.
• [21] Spinacia oleracea extract attenuates disease progression and sub-chondral bone changes in monosodium iodoacetate-induced osteoarthritis in rats.BMC Complement Altern Med. 2018 Feb 20;18(1):69. doi: 10.1186/s12906-018-2117-9.
• [22] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [23] Polymorphism of glutathione S-transferase M1 and T1 genes and susceptibility to psoriasis disease: A study from North India.Indian J Dermatol Venereol Leprol. 2018 Jan-Feb;84(1):39-44. doi: 10.4103/ijdvl.IJDVL_1128_16.
• [24] GSTM1 genotype is an independent prognostic factor in clear cell renal cell carcinoma.Urol Oncol. 2017 Jun;35(6):409-417. doi: 10.1016/j.urolonc.2017.02.005. Epub 2017 Mar 9.
• [25] Oxidative stress in drug-nave first episode patients with schizophrenia and major depression: effects of disease acuity and potential confounders.Eur Arch Psychiatry Clin Neurosci. 2018 Mar;268(2):129-143. doi: 10.1007/s00406-016-0749-7. Epub 2016 Dec 2.
• [26] Genetic variants in CYP and GST genes, smoking and risk for head and neck cancers: a gene-environment interaction hospital-based case-control study among Canadian Caucasians.Carcinogenesis. 2019 Sep 18;40(9):1061-1069. doi: 10.1093/carcin/bgz051.
• [27] Application of Various Statistical Models to Explore Gene-Gene Interactions in Folate, Xenobiotic, Toll-Like Receptor and STAT4 Pathways that Modulate Susceptibility to Systemic Lupus Erythematosus.Mol Diagn Ther. 2016 Feb;20(1):83-95. doi: 10.1007/s40291-015-0181-0.
• [28] Plasma mtDNA copy numbers are associated with GSTK1 expression and inflammation in type 2 diabetes.Diabet Med. 2020 Nov;37(11):1874-1878. doi: 10.1111/dme.14132. Epub 2019 Sep 17.
• [29] Expression of maspin and glutathionine-S-transferase-pi in normal human prostate and prostatic carcinomas.Appl Immunohistochem Mol Morphol. 2010 Oct;18(5):429-32. doi: 10.1097/PAI.0b013e3181dbc77e.
• [30] Genetic Contribution of Polymorphisms in Glutathione S-Transferases to Brain Tumor Risk.Mol Neurobiol. 2016 Apr;53(3):1730-1740. doi: 10.1007/s12035-015-9097-2. Epub 2015 Mar 4.
• [31] GSTM1 and GSTT1 null polymorphisms and male infertility risk: an updated meta-analysis encompassing 6934 subjects.Sci Rep. 2013;3:2258. doi: 10.1038/srep02258.
• [32] Influence of antioxidants' gene variants on risk of diabetes mellitus and its complications: a systematic review.Minerva Endocrinol. 2019 Sep;44(3):310-325. doi: 10.23736/S0391-1977.17.02632-3. Epub 2017 May 26.
• [33] Recombinant preparation and functional studies of EspI ATP binding domain from Mycobacterium tuberculosis.Protein Expr Purif. 2016 Jul;123:51-9. doi: 10.1016/j.pep.2016.03.009. Epub 2016 Mar 25.
• [34] Genetic variants of glutathione S-transferase and the risk of acute myeloid leukemia in a Saudi population.Saudi J Biol Sci. 2019 Nov;26(7):1525-1530. doi: 10.1016/j.sjbs.2018.12.011. Epub 2018 Dec 21.
• [35] Genetic susceptibility of glutathione S-transferase genes (GSTM1/T1 and P1) to coronary artery disease in Asian Indians.Ann Hum Genet. 2018 Nov;82(6):448-456. doi: 10.1111/ahg.12274. Epub 2018 Jul 24.
• [36] Glutathione S-transferase M1 and T1 gene polymorphisms and risk of endometriosis in Tunisian population.Hum Fertil (Camb). 2015 Jun;18(2):128-33. doi: 10.3109/14647273.2014.989925. Epub 2014 Dec 30.
• [37] Piperlongumine and p53-reactivator APR-246 selectively induce cell death in HNSCC by targeting GSTP1.Oncogene. 2018 Jun;37(25):3384-3398. doi: 10.1038/s41388-017-0110-2. Epub 2018 Jan 18.
• [38] Dysbindin-1, a schizophrenia-related protein, functionally interacts with the DNA- dependent protein kinase complex in an isoform-dependent manner.PLoS One. 2009;4(1):e4199. doi: 10.1371/journal.pone.0004199. Epub 2009 Jan 14.
• [39] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [40] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [41] Expression Profiling of Human Pluripotent Stem Cell-Derived Cardiomyocytes Exposed to Doxorubicin-Integration and Visualization of Multi-Omics Data. Toxicol Sci. 2018 May 1;163(1):182-195. doi: 10.1093/toxsci/kfy012.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [46] Neuroprotective effects of glucomoringin-isothiocyanate against H(2)O(2)-Induced cytotoxicity in neuroblastoma (SH-SY5Y) cells. Neurotoxicology. 2019 Dec;75:89-104. doi: 10.1016/j.neuro.2019.09.008. Epub 2019 Sep 12.
• [47] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [48] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [49] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [50] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [51] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [52] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [53] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [54] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [55] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [56] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.