Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHDO0QG)

• DOT Name: Receptor-type tyrosine-protein phosphatase U (PTPRU)
• Synonyms: R-PTP-U; EC 3.1.3.48; Pancreatic carcinoma phosphatase 2; PCP-2; Protein-tyrosine phosphatase J; PTP-J; hPTP-J; Protein-tyrosine phosphatase pi; PTP pi; Protein-tyrosine phosphatase receptor omicron; PTP-RO; Receptor-type protein-tyrosine phosphatase psi; R-PTP-psi
• Gene Name: PTPRU
• Related Disease:
  B-cell neoplasm
  Glioma
  Parkinson disease
  T-cell acute lymphoblastic leukaemia
  Acute myelogenous leukaemia
  Astrocytoma
  Autoimmune disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Epithelial ovarian cancer
  High blood pressure
  Inflammatory bowel disease
  Leukemia
  Lung cancer
  Lung neoplasm
  Membranous glomerulonephritis
  Mental disorder
  Non-insulin dependent diabetes
  Noonan syndrome
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic adenocarcinoma
  Renal cell carcinoma
  Systemic lupus erythematosus
  Type-1 diabetes
  Carcinoma
  Lung adenocarcinoma
  Melanoma
  Type-1/2 diabetes
  Rheumatoid arthritis
  Advanced cancer
  Gastric cancer
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Hyperglycemia
  Kidney neoplasm
  Lung carcinoma
  Obesity
  Pancreatic cancer
• UniProt ID: PTPRU_HUMAN
• PDB ID: 6SUB; 6SUC
• EC Number: 3.1.3.48
• Pfam ID: PF00041 ; PF00629 ; PF00102
• Sequence:
  MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
  RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
  VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
  LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
  SHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
  YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
  RPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
  LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
  TDEDVPSGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
  RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
  LGESENTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARG
  LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
  IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYS
  YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS
  GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
  FFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
  TQGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTE
  TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
  IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
  ILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
  PRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
  FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARV
  FRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHC
  LNGGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
  EGLESR
• Function: Tyrosine-protein phosphatase which dephosphorylates CTNNB1. Regulates CTNNB1 function both in cell adhesion and signaling. May function in cell proliferation and migration and play a role in the maintenance of epithelial integrity. May play a role in megakaryocytopoiesis.
• Tissue Specificity: High levels in brain, pancreas, and skeletal muscle; less in colon, kidney, liver, stomach, and uterus; not expressed in placenta and spleen. Also detected in heart, prostate, lung, thymus, testis and ovary. Ubiquitously expressed in brain. Expressed by hematopoietic stem cells.
• Reactome Pathway: Signaling by SCF-KIT (R-HSA-1433557)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Genetic Variation	[1]
Glioma	DIS5RPEH	Definitive	Altered Expression	[2]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[3]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Definitive	Genetic Variation	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[4]
Astrocytoma	DISL3V18	Strong	Genetic Variation	[5]
Autoimmune disease	DISORMTM	Strong	Biomarker	[6]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[10]
Colon cancer	DISVC52G	Strong	Biomarker	[8]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[11]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[14]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[15]
Leukemia	DISNAKFL	Strong	Biomarker	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[17]
Lung neoplasm	DISVARNB	Strong	Genetic Variation	[18]
Membranous glomerulonephritis	DISFSUKQ	Strong	Biomarker	[19]
Mental disorder	DIS3J5R8	Strong	Biomarker	[20]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[21]
Noonan syndrome	DIS7Q7DN	Strong	Biomarker	[22]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[7]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[13]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Biomarker	[23]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[10]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[6]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[24]
Carcinoma	DISH9F1N	moderate	Biomarker	[25]
Lung adenocarcinoma	DISD51WR	moderate	Altered Expression	[26]
Melanoma	DIS1RRCY	moderate	Altered Expression	[27]
Type-1/2 diabetes	DISIUHAP	moderate	Genetic Variation	[28]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[29]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[30]
Gastric cancer	DISXGOUK	Limited	Genetic Variation	[31]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[32]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[33]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[34]
Kidney neoplasm	DISBNZTN	Limited	Altered Expression	[35]
Lung carcinoma	DISTR26C	Limited	Biomarker	[17]
Obesity	DIS47Y1K	Limited	Altered Expression	[36]
Pancreatic cancer	DISJC981	Limited	Biomarker	[37]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[41]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[44]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[45]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[46]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[47]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[50]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[53]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[54]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[48]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[51]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Receptor-type tyrosine-protein phosphatase U (PTPRU).	[52]

References

• [1] TC-PTP and PTP1B: Regulating JAK-STAT signaling, controlling lymphoid malignancies.Cytokine. 2016 Jun;82:52-7. doi: 10.1016/j.cyto.2015.12.025. Epub 2016 Jan 23.
• [2] Protein tyrosine phosphatase receptor U (PTPRU) is required for glioma growth and motility.Carcinogenesis. 2014 Aug;35(8):1901-10. doi: 10.1093/carcin/bgu123. Epub 2014 May 29.
• [3] Mitochondrial permeability transition pore: a promising target for the treatment of Parkinson's disease.Protoplasma. 2017 Jan;254(1):33-42. doi: 10.1007/s00709-015-0930-2. Epub 2016 Jan 29.
• [4] NOX4-driven ROS formation mediates PTP inactivation and cell transformation in FLT3ITD-positive AML cells.Leukemia. 2016 Feb;30(2):473-83. doi: 10.1038/leu.2015.234. Epub 2015 Aug 26.
• [5] Protein tyrosine phosphatase mu regulates glioblastoma cell growth and survival in vivo.Neuro Oncol. 2012 May;14(5):561-73. doi: 10.1093/neuonc/nos066. Epub 2012 Apr 14.
• [6] Identification and Characterization of Post-activated B Cells in Systemic Autoimmune Diseases.Front Immunol. 2019 Sep 24;10:2136. doi: 10.3389/fimmu.2019.02136. eCollection 2019.
• [7] Human protein tyrosine phosphatase-sigma: alternative splicing and inhibition by bisphosphonates. J Bone Miner Res. 1996 Apr;11(4):535-43.
• [8] Apoptosis of estrogen-receptor negative breast cancer and colon cancer cell lines by PTP alpha and src RNAi.Int J Cancer. 2008 May 1;122(9):1999-2007. doi: 10.1002/ijc.23321.
• [9] The Role of Protein Tyrosine Phosphatase (PTP)-1B in Cardiovascular Disease and Its Interplay with Insulin Resistance.Biomolecules. 2019 Jul 17;9(7):286. doi: 10.3390/biom9070286.
• [10] Structure of the human receptor tyrosine phosphatase gamma gene (PTPRG) and relation to the familial RCC t(3;8) chromosome translocation.Genomics. 1996 Mar 1;32(2):225-35. doi: 10.1006/geno.1996.0109.
• [11] A missense variant in PTPN12 associated with the risk of colorectal cancer by modifying Ras/MEK/ERK signaling.Cancer Epidemiol. 2019 Apr;59:109-114. doi: 10.1016/j.canep.2019.01.013. Epub 2019 Feb 4.
• [12] Frameshift mutations in coding repeats of protein tyrosine phosphatase genes in colorectal tumors with microsatellite instability.BMC Cancer. 2008 Nov 10;8:329. doi: 10.1186/1471-2407-8-329.
• [13] A water-soluble polysaccharide from the roots of Polygala tenuifolia suppresses ovarian tumor growth and angiogenesis in vivo.Int J Biol Macromol. 2018 Feb;107(Pt A):713-718. doi: 10.1016/j.ijbiomac.2017.09.043. Epub 2017 Sep 15.
• [14] Single nucleotide polymorphisms in protein tyrosine phosphatase 1beta (PTPN1) are associated with essential hypertension and obesity.Hum Mol Genet. 2004 Sep 1;13(17):1885-92. doi: 10.1093/hmg/ddh196. Epub 2004 Jun 30.
• [15] Protein tyrosine phosphatase targets apical junction complex proteins in the intestine and regulates epithelial permeability.Proc Natl Acad Sci U S A. 2014 Jan 14;111(2):693-8. doi: 10.1073/pnas.1315017111. Epub 2014 Jan 2.
• [16] Targeting protein tyrosine phosphatase SHP2 for the treatment of PTPN11-associated malignancies.Mol Cancer Ther. 2013 Sep;12(9):1738-48. doi: 10.1158/1535-7163.MCT-13-0049-T. Epub 2013 Jul 3.
• [17] Molecular analysis of the protein tyrosine phosphatase gamma gene in human lung cancer cell lines.Cancer Res. 1992 Jun 15;52(12):3506-9.
• [18] Receptor protein-tyrosine phosphatase gamma is a candidate tumor suppressor gene at human chromosome region 3p21.Proc Natl Acad Sci U S A. 1991 Jun 1;88(11):5036-40. doi: 10.1073/pnas.88.11.5036.
• [19] Early changes in gene expression that influence the course of primary glomerular disease.Kidney Int. 2007 Aug;72(3):337-47. doi: 10.1038/sj.ki.5002302. Epub 2007 Apr 25.
• [20] Exploring mental illness stigma among Asian men mobilized to become Community Mental Health Ambassadors in Toronto Canada.Ethn Health. 2022 Jan;27(1):100-118. doi: 10.1080/13557858.2019.1640350. Epub 2019 Jul 24.
• [21] Antisense Inhibition of Protein Tyrosine Phosphatase 1B With IONIS-PTP-1B(Rx) Improves Insulin Sensitivity and Reduces Weight in Overweight Patients With Type 2 Diabetes.Diabetes Care. 2018 Apr;41(4):807-814. doi: 10.2337/dc17-2132. Epub 2018 Feb 9.
• [22] Identification of demethylincisterol A(3) as a selective inhibitor of protein tyrosine phosphatase Shp2.Eur J Pharmacol. 2017 Jan 15;795:124-133. doi: 10.1016/j.ejphar.2016.12.012. Epub 2016 Dec 8.
• [23] Characterization of PCP-2, a novel receptor protein tyrosine phosphatase of the MAM domain family.Oncogene. 1996 Jun 20;12(12):2555-62.
• [24] IA-2 antibody epitopes and isotypes during the prediabetic process in siblings of children with type 1 diabetes.J Autoimmun. 2004 Dec;23(4):361-70. doi: 10.1016/j.jaut.2004.09.005.
• [25] Expression of oxidized protein tyrosine phosphatase and H2AX predicts poor survival of gastric carcinoma patients.BMC Cancer. 2018 Aug 20;18(1):836. doi: 10.1186/s12885-018-4752-4.
• [26] Inhibition of Shp2 suppresses mutant EGFR-induced lung tumors in transgenic mouse model of lung adenocarcinoma.Oncotarget. 2015 Mar 20;6(8):6191-202. doi: 10.18632/oncotarget.3356.
• [27] Microarray analysis of phosphatase gene expression in human melanoma.Br J Dermatol. 2005 May;152(5):925-30. doi: 10.1111/j.1365-2133.2005.06454.x.
• [28] Early development and spreading of autoantibodies to epitopes of IA-2 and their association with progression to type 1 diabetes.J Immunol. 1998 Dec 15;161(12):6963-9.
• [29] Muscle Deficits in Rheumatoid Arthritis Contribute to Inferior Cortical Bone Structure and Trabecular Bone Mineral Density.J Rheumatol. 2017 Dec;44(12):1777-1785. doi: 10.3899/jrheum.170513. Epub 2017 Sep 15.
• [30] Design, Synthesis, and In Vitro Activity of Pyrazine Compounds.Molecules. 2019 Dec 1;24(23):4389. doi: 10.3390/molecules24234389.
• [31] Mutational analysis of mononucleotide repeats in dual specificity tyrosine phosphatase genes in gastric and colon carcinomas with microsatellite instability.APMIS. 2010 May;118(5):389-93. doi: 10.1111/j.1600-0463.2010.02612.x.
• [32] High Expression of PTPN3 Predicts Progression and Unfavorable Prognosis of Glioblastoma.Med Sci Monit. 2018 Oct 23;24:7556-7562. doi: 10.12659/MSM.911531.
• [33] The Roles of Protein Tyrosine Phosphatases in Hepatocellular Carcinoma.Cancers (Basel). 2018 Mar 20;10(3):82. doi: 10.3390/cancers10030082.
• [34] Identification of the tyrosine phosphatase PTP-MEG2 as an antagonist of hepatic insulin signaling.Cell Metab. 2006 May;3(5):367-78. doi: 10.1016/j.cmet.2006.03.006.
• [35] 17 beta-estradiol-regulated expression of protein tyrosine phosphatase gamma gene in cultured human normal breast and breast cancer cells.Anticancer Res. 2000 Jan-Feb;20(1A):11-9.
• [36] Bioelectrical impedance vector analysis in obese and overweight children.PLoS One. 2019 Jan 24;14(1):e0211148. doi: 10.1371/journal.pone.0211148. eCollection 2019.
• [37] A novel plectin/integrin-targeted bispecific molecular probe for magnetic resonance/near-infrared imaging of pancreatic cancer.Biomaterials. 2018 Nov;183:173-184. doi: 10.1016/j.biomaterials.2018.08.048. Epub 2018 Aug 26.
• [38] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [39] The retinoid anticancer signal: mechanisms of target gene regulation. Br J Cancer. 2005 Aug 8;93(3):310-8. doi: 10.1038/sj.bjc.6602700.
• [40] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [43] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [44] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [45] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [46] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [47] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [48] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [49] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [50] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [51] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [52] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [53] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [54] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.