Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHLVA9G)

DOT Name	Tenomodulin (TNMD)
Synonyms	TeM; hTeM; Chondromodulin-1-like protein; ChM1L; hChM1L; Chondromodulin-I-like protein; Myodulin; Tendin
Gene Name	TNMD
Related Disease	Bacteremia ( ) Brucellosis ( ) Melanoma ( ) Metabolic disorder ( ) Mycoses ( ) Nephropathy ( ) Ovarian cancer ( ) Acute graft versus host disease ( ) Acute lymphocytic leukaemia ( ) Adenoma ( ) Advanced cancer ( ) Age-related macular degeneration ( ) Alkaptonuria ( ) Alzheimer disease ( ) Amyloidosis ( ) Cataract ( ) Diabetic kidney disease ( ) Familial adenomatous polyposis ( ) Gonorrhea ( ) Hemochromatosis ( ) Influenza ( ) Lung adenocarcinoma ( ) Mucopolysaccharidosis ( ) Mucopolysaccharidosis type IIIA ( ) Neoplasm ( ) Non-insulin dependent diabetes ( ) Obesity ( ) Parkinson disease ( ) Premature aging syndrome ( ) Pulmonary disease ( ) Retinitis pigmentosa ( ) Thrombocytopenia ( ) Triple negative breast cancer ( ) Urinary tract infection ( ) Vibrio cholerae infection ( ) Bloom syndrome ( ) Glioblastoma multiforme ( ) Methicillin-resistant staphylococci infection ( ) Nephrocalcinosis ( ) Type-1/2 diabetes ( ) Bone osteosarcoma ( ) Connective tissue disorder ( ) Epithelial ovarian cancer ( ) Glioma ( ) Osteosarcoma ( )
UniProt ID	TNMD_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF04089
Sequence	MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKK AYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKC FIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDN VTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASE EELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVIC RVIMPCNWWVARMLGRV
Function	May be an angiogenesis inhibitor.
Tissue Specificity	Highly expressed in hypovascular connective tissues such as tendons. Has also strong expression in adipose tissue.

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Bacteremia	DIS6N9RZ	Definitive	Genetic Variation	[1]
Brucellosis	DISEAYGH	Definitive	Biomarker	[2]
Melanoma	DIS1RRCY	Definitive	Biomarker	[3]
Metabolic disorder	DIS71G5H	Definitive	Altered Expression	[4]
Mycoses	DIS9K7PB	Definitive	Biomarker	[5]
Nephropathy	DISXWP4P	Definitive	Biomarker	[6]
Ovarian cancer	DISZJHAP	Definitive	Biomarker	[3]
Acute graft versus host disease	DIS8KLVM	Strong	Biomarker	[7]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[8]
Adenoma	DIS78ZEV	Strong	Biomarker	[9]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[10]
Age-related macular degeneration	DIS0XS2C	Strong	Genetic Variation	[11]
Alkaptonuria	DISXDZWS	Strong	Biomarker	[12]
Alzheimer disease	DISF8S70	Strong	Biomarker	[13]
Amyloidosis	DISHTAI2	Strong	Biomarker	[14]
Cataract	DISUD7SL	Strong	Biomarker	[15]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[16]
Familial adenomatous polyposis	DISW53RE	Strong	Genetic Variation	[17]
Gonorrhea	DISQ5AO6	Strong	Biomarker	[18]
Hemochromatosis	DISAPY0H	Strong	Biomarker	[19]
Influenza	DIS3PNU3	Strong	Biomarker	[20]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[21]
Mucopolysaccharidosis	DISB083T	Strong	Genetic Variation	[22]
Mucopolysaccharidosis type IIIA	DISP7DR6	Strong	Biomarker	[22]
Neoplasm	DISZKGEW	Strong	Biomarker	[23]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[24]
Obesity	DIS47Y1K	Strong	Genetic Variation	[24]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[13]
Premature aging syndrome	DIS51AGT	Strong	Biomarker	[25]
Pulmonary disease	DIS6060I	Strong	Biomarker	[26]
Retinitis pigmentosa	DISCGPY8	Strong	Biomarker	[15]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[27]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[28]
Urinary tract infection	DISMT6UV	Strong	Biomarker	[29]
Vibrio cholerae infection	DISW7E3U	Strong	Genetic Variation	[30]
Bloom syndrome	DISKXQ7J	moderate	Biomarker	[31]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[32]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[33]
Nephrocalcinosis	DIS5ZVJP	moderate	Biomarker	[34]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[35]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[36]
Connective tissue disorder	DISKXBS3	Limited	Biomarker	[37]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[3]
Glioma	DIS5RPEH	Limited	Biomarker	[38]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[36]
------------------------------------------------------------------------------------


⏷ Show the Full List of 45 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Tenomodulin (TNMD).	[39]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Tenomodulin (TNMD).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Tenomodulin (TNMD).	[39]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Tenomodulin (TNMD).	[41]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Tenomodulin (TNMD).	[42]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Tenomodulin (TNMD).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tenomodulin (TNMD).	[45]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Tenomodulin (TNMD).	[44]
------------------------------------------------------------------------------------

References

1	Bacteremia due to Klebsiella pneumoniae isolates producing the TEM-52 extended-spectrum beta-lactamase: treatment outcome of patients receiving imipenem or ciprofloxacin.Clin Infect Dis. 2004 Jan 15;38(2):243-51. doi: 10.1086/380645. Epub 2003 Dec 19.
2	The detection of brucellosis antibody in whole serum based on the low-fouling electrochemical immunosensor fabricated with magnetic Fe(3)O(4)@Au@PEG@HA nanoparticles.Biosens Bioelectron. 2018 Oct 15;117:138-144. doi: 10.1016/j.bios.2018.06.010. Epub 2018 Jun 6.
3	Cytotoxicity of Nubein6.8 peptide isolated from the snake venom of Naja nubiae on melanoma and ovarian carcinoma cell lines.Toxicon. 2019 Oct;168:22-31. doi: 10.1016/j.toxicon.2019.06.220. Epub 2019 Jun 21.
4	Tenomodulin is highly expressed in adipose tissue, increased in obesity, and down-regulated during diet-induced weight loss.J Clin Endocrinol Metab. 2009 Oct;94(10):3987-94. doi: 10.1210/jc.2009-0292. Epub 2009 Jul 14.
5	Two New 1,3,4-Oxadiazoles With Effective Antifungal Activity Against Candida albicans.Front Microbiol. 2019 Sep 12;10:2130. doi: 10.3389/fmicb.2019.02130. eCollection 2019.
6	Electron microscopy in kidney research: seeing is believing.Ultrastruct Pathol. 2013 Oct;37(5):340-5. doi: 10.3109/01913123.2013.810689. Epub 2013 Jul 22.
7	Peripheral Blood CD38 Bright CD8+ Effector Memory T Cells Predict Acute Graft-versus-Host Disease.Biol Blood Marrow Transplant. 2015 Jul;21(7):1215-22. doi: 10.1016/j.bbmt.2015.04.010. Epub 2015 Apr 13.
8	Large-scale isolation and cytotoxicity of extracellular vesicles derived from activated human natural killer cells.J Extracell Vesicles. 2017 Feb 28;6(1):1294368. doi: 10.1080/20013078.2017.1294368. eCollection 2017.
9	Importance of Resection Margins in the Treatment of Rectal Adenomas by Transanal Endoscopic Surgery.J Gastrointest Surg. 2019 Sep;23(9):1874-1883. doi: 10.1007/s11605-018-3980-x. Epub 2018 Oct 10.
10	Biosynthesis of selenium nanoparticles, characterization and X-ray induced radiotherapy for the treatment of lung cancer with interstitial lung disease.J Photochem Photobiol B. 2019 Feb;191:123-127. doi: 10.1016/j.jphotobiol.2018.12.008. Epub 2018 Dec 11.
11	Tenomodulin gene and obesity-related phenotypes.Ann Med. 2010 May 6;42(4):265-75. doi: 10.3109/07853891003801123.
12	Cytoskeleton Aberrations in Alkaptonuric Chondrocytes.J Cell Physiol. 2017 Jul;232(7):1728-1738. doi: 10.1002/jcp.25500. Epub 2017 Jan 31.
13	Reducing INS-IGF1 signaling protects against non-cell autonomous vesicle rupture caused by SNCA spreading.Autophagy. 2020 May;16(5):878-899. doi: 10.1080/15548627.2019.1643657. Epub 2019 Jul 29.
14	Destabilization of -amyloid aggregates by thrombin derived peptide: plausible role of thrombin in neuroprotection.FEBS J. 2020 Jun;287(11):2386-2413. doi: 10.1111/febs.15149. Epub 2020 Jan 3.
15	Anterior lens epithelium in cataract patients with retinitis pigmentosa - scanning and transmission electron microscopy study.Acta Ophthalmol. 2017 May;95(3):e212-e220. doi: 10.1111/aos.13250. Epub 2016 Sep 28.
16	Renoprotection From Diabetic Complications in OVE Transgenic Mice by Endothelial Cell Specific Overexpression of Metallothionein: A TEM Stereological Analysis.Anat Rec (Hoboken). 2017 Mar;300(3):560-576. doi: 10.1002/ar.23511. Epub 2017 Jan 11.
17	The most pathogenic transthyretin variant, L55P, forms amyloid fibrils under acidic conditions and protofilaments under physiological conditions.Biochemistry. 1999 Oct 12;38(41):13560-73. doi: 10.1021/bi991021c.
18	Gonococcal Antimicrobial Susceptibility and the Prevalence of bla(TEM-1) and bla(TEM-135) Genes in Neisseria gonorrhoeae Isolates from Thailand.Jpn J Infect Dis. 2017 Mar 24;70(2):213-215. doi: 10.7883/yoken.JJID.2016.209. Epub 2016 Aug 31.
19	Hereditary hemochromatosis of a young girl: detection of early iron deposition in liver cell lysosomes using transmission electron microscopy and electron energy loss spectroscopy.Ultrastruct Pathol. 2002 Jan-Feb;26(1):23-6. doi: 10.1080/01913120252934297.
20	Presence of ROB-1 beta-lactamase correlates with cefaclor resistance among recent isolates of Haemophilus influenzae.J Antimicrob Chemother. 2000 Jun;45(6):871-5. doi: 10.1093/jac/45.6.871.
21	Design of Block Copolymer Micellar Aggregates for Co-Delivery of Enzyme and Anticancer Prodrug.Chem Asian J. 2017 Jan 17;12(2):176-180. doi: 10.1002/asia.201601198. Epub 2016 Dec 14.
22	Trehalose reduces retinal degeneration, neuroinflammation and storage burden caused by a lysosomal hydrolase deficiency.Autophagy. 2018;14(8):1419-1434. doi: 10.1080/15548627.2018.1474313. Epub 2018 Jul 23.
23	Identification of protein targets and the mechanism of the cytotoxic action of Ipomoea turpethum extract loaded nanoparticles against breast cancer cells.J Mater Chem B. 2019 Oct 9;7(39):6048-6063. doi: 10.1039/c9tb00824a.
24	Effects of X-chromosome Tenomodulin Genetic Variants on Obesity in a Children's Cohort and Implications of the Gene in Adipocyte Metabolism.Sci Rep. 2019 Mar 8;9(1):3979. doi: 10.1038/s41598-019-40482-0.
25	Tenomodulin is Required for Tendon Endurance Running and Collagen I Fibril Adaptation to Mechanical Load.EBioMedicine. 2017 Jun;20:240-254. doi: 10.1016/j.ebiom.2017.05.003. Epub 2017 May 5.
26	Ultrastructure of lamellar bodies in congenital surfactant deficiency.Ultrastruct Pathol. 2005 Nov-Dec;29(6):503-9. doi: 10.1080/01913120500323480.
27	An audit of the diagnostic accuracy of rotational thromboelastometry for the identification of hypofibrinogenaemia and thrombocytopenia during cardiopulmonary bypass.Anaesth Intensive Care. 2018 Nov;46(6):620-626. doi: 10.1177/0310057X1804600614.
28	The Chk1 inhibitor MK-8776 increases the radiosensitivity of human triple-negative breast cancer by inhibiting autophagy.Acta Pharmacol Sin. 2017 Apr;38(4):513-523. doi: 10.1038/aps.2016.136. Epub 2017 Jan 2.
29	Carbapenem-Resistant KPC- and TEM-Producing Escherichia coli ST131 Isolated from a Hospitalized Patient with Urinary Tract Infection: First Isolation in Molise Region, Central Italy, July 2018.Microb Drug Resist. 2020 Jan;26(1):38-45. doi: 10.1089/mdr.2019.0085. Epub 2019 Aug 6.
30	Genetic characterization of multidrug-resistant, extended-spectrum- -lactamase-producing Vibrio cholerae O1 outbreak strains, Mpumalanga, South Africa, 2008.J Clin Microbiol. 2011 Aug;49(8):2976-9. doi: 10.1128/JCM.00293-11. Epub 2011 Jun 8.
31	The role of the secondary phloem during the development of the grapevine Berry Shrivel ripening disorder.Micron. 2019 Jan;116:36-45. doi: 10.1016/j.micron.2018.09.012. Epub 2018 Sep 27.
32	Molecularly Targeted Drugs Plus Radiotherapy and Temozolomide Treatment for Newly Diagnosed Glioblastoma: A Meta-Analysis and Systematic Review.Oncol Res. 2016;24(2):117-28. doi: 10.3727/096504016X14612603423511.
33	Simultaneous occurrence of MRSA and ESBL-producing Enterobacteriaceae on pig farms and in nasal and stool samples from farmers.Vet Microbiol. 2017 Feb;200:107-113. doi: 10.1016/j.vetmic.2016.05.021. Epub 2016 Jun 1.
34	Establishment of urinary exosome-like vesicles isolation protocol for FHHNC patients and evaluation of different exosomal RNA extraction methods.J Transl Med. 2018 Oct 11;16(1):278. doi: 10.1186/s12967-018-1651-z.
35	Tenomodulin is associated with obesity and diabetes risk: the Finnish diabetes prevention study.Obesity (Silver Spring). 2007 May;15(5):1082-8. doi: 10.1038/oby.2007.613.
36	Analysis of Minerals Produced by hFOB 1.19 and Saos-2 Cells Using Transmission Electron Microscopy with Energy Dispersive X-ray Microanalysis.J Vis Exp. 2018 Jun 24;(136):57423. doi: 10.3791/57423.
37	Mitral valve prolapse.Annu Rev Med. 2012;63:277-92. doi: 10.1146/annurev-med-022811-091602.
38	Tie2 identifies a hematopoietic lineage of proangiogenic monocytes required for tumor vessel formation and a mesenchymal population of pericyte progenitors.Cancer Cell. 2005 Sep;8(3):211-26. doi: 10.1016/j.ccr.2005.08.002.
39	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
40	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
41	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
42	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
43	Resveratrol modulates interleukin-1-induced phosphatidylinositol 3-kinase and nuclear factor B signaling pathways in human tenocytes. J Biol Chem. 2012 Nov 2;287(45):38050-63. doi: 10.1074/jbc.M112.377028. Epub 2012 Aug 30.
44	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
45	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.