Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHU9MRX)

DOT Name Golgin subfamily A member 6A (GOLGA6A)
Synonyms Golgin linked to PML; Golgin-like protein
Gene Name GOLGA6A
Related Disease
Coronary atherosclerosis ( )
Coronary heart disease ( )
Parkinson disease ( )
Type-1 diabetes ( )
Acute myelogenous leukaemia ( )
Acute myocardial infarction ( )
Alzheimer disease ( )
Amyloidosis ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Bipolar disorder ( )
Cardiovascular disease ( )
Chronic kidney disease ( )
Cognitive impairment ( )
Diabetic kidney disease ( )
Diabetic retinopathy ( )
Epithelial ovarian cancer ( )
Fatty liver disease ( )
Hutchinson-Gilford progeria syndrome ( )
Hyperglycemia ( )
Hyperlipidemia ( )
Insulinoma ( )
Kleefstra syndrome ( )
Kleefstra syndrome 1 ( )
Neoplasm ( )
Nephropathy ( )
Non-alcoholic fatty liver disease ( )
Obesity ( )
Osteoporosis ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic tumour ( )
Prader-Willi syndrome ( )
Retinopathy ( )
Schizophrenia ( )
Stroke ( )
leukaemia ( )
Leukemia ( )
Type-1/2 diabetes ( )
Pancreatic cancer ( )
Cardiomyopathy ( )
Chronic renal failure ( )
End-stage renal disease ( )
Hepatitis ( )
Myocardial infarction ( )
Pancreatitis ( )
Small lymphocytic lymphoma ( )
Trichohepatoenteric syndrome ( )
UniProt ID
GOG6A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15070
Sequence
MWPQPYLPPHPMMLEESRQNKLAAAKKKLKEYQQRKSPGIPAGAKTKKKKTDSSPETTTS
GGCHSPGDSQYQELAVALESSSVTISQLNENIESLKQQKKQVEHQLEEAKKTNNEIHKAQ
MERLETINILTLEKADLKTTLYHTKRAARHFEEESKDLAGRLQYSLQRIQELERALCAVS
TQQQEEDRSSSCREAVLQRWLQQTIKERALLNAHVTQVTESLKQVQLERDEYAKHIKGER
ARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQMAEPPSLAPPAVTSVVEQL
QDEAKHLRQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEAQRVREQERL
CEQNERLREQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKE
ERLQKQEERLALSQNHKLDKQLAEPQCSFEDLNNEKKSALQLEQQVKELQEKLDEEHLEA
ASHQNQQLETQLSLVALPGEGDGGQHLDSEEEEAPRPTPNIPEDLESREATSSFMDLPKE
KADGTEQVERRELGFVQPSGVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLAQKEEEMK
VKLLELQELVLPLVGNHEGHGKFLIAAQNPADEPTPGAPAPQELGAAGEQDVFYEVSLDN
NVEPAPGAAREGSPHDNPTVQQIVQLSPVMQDT
Tissue Specificity
Highly expressed in seminiferous tubes in testis. Highly expressed in spermatids, barely detectable in late pachytene spermatocytes, and not detectable in spermatogonia. Detected at intermediate levels in pancreas and lymph nodes, and at much lower levels in spleen, peripheral blood leukocytes, skeletal muscle, liver, lung, placenta, brain and heart.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Coronary atherosclerosis DISKNDYU Definitive Genetic Variation [1]
Coronary heart disease DIS5OIP1 Definitive Genetic Variation [1]
Parkinson disease DISQVHKL Definitive Biomarker [2]
Type-1 diabetes DIS7HLUB Definitive Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Strong Biomarker [4]
Acute myocardial infarction DISE3HTG Strong Biomarker [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Amyloidosis DISHTAI2 Strong Biomarker [7]
Arteriosclerosis DISK5QGC Strong Biomarker [8]
Atherosclerosis DISMN9J3 Strong Biomarker [8]
Bipolar disorder DISAM7J2 Strong Genetic Variation [9]
Cardiovascular disease DIS2IQDX Strong Biomarker [10]
Chronic kidney disease DISW82R7 Strong Biomarker [11]
Cognitive impairment DISH2ERD Strong Biomarker [12]
Diabetic kidney disease DISJMWEY Strong Biomarker [13]
Diabetic retinopathy DISHGUJM Strong Biomarker [14]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [15]
Fatty liver disease DIS485QZ Strong Biomarker [16]
Hutchinson-Gilford progeria syndrome DISY55BU Strong Altered Expression [17]
Hyperglycemia DIS0BZB5 Strong Biomarker [18]
Hyperlipidemia DIS61J3S Strong Biomarker [19]
Insulinoma DISIU1JS Strong Biomarker [20]
Kleefstra syndrome DISHH9SN Strong Genetic Variation [21]
Kleefstra syndrome 1 DISNODDM Strong Genetic Variation [21]
Neoplasm DISZKGEW Strong Biomarker [22]
Nephropathy DISXWP4P Strong Genetic Variation [23]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [24]
Obesity DIS47Y1K Strong Biomarker [25]
Osteoporosis DISF2JE0 Strong Biomarker [26]
Ovarian cancer DISZJHAP Strong Biomarker [15]
Ovarian neoplasm DISEAFTY Strong Biomarker [15]
Pancreatic tumour DIS3U0LK Strong Biomarker [27]
Prader-Willi syndrome DISYWMLU Strong Biomarker [28]
Retinopathy DISB4B0F Strong Genetic Variation [29]
Schizophrenia DISSRV2N Strong Biomarker [30]
Stroke DISX6UHX Strong Genetic Variation [31]
leukaemia DISS7D1V moderate Biomarker [32]
Leukemia DISNAKFL moderate Biomarker [32]
Type-1/2 diabetes DISIUHAP moderate Biomarker [33]
Pancreatic cancer DISJC981 Disputed Genetic Variation [34]
Cardiomyopathy DISUPZRG Limited Posttranslational Modification [35]
Chronic renal failure DISGG7K6 Limited Biomarker [36]
End-stage renal disease DISXA7GG Limited Biomarker [36]
Hepatitis DISXXX35 Limited Biomarker [37]
Myocardial infarction DIS655KI Limited Genetic Variation [31]
Pancreatitis DIS0IJEF Limited Genetic Variation [38]
Small lymphocytic lymphoma DIS30POX Limited Altered Expression [39]
Trichohepatoenteric syndrome DISL3ODF Limited Genetic Variation [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Golgin subfamily A member 6A (GOLGA6A). [40]
------------------------------------------------------------------------------------

References

1 Polymorphisms in the Glucagon-Like Peptide 1 Receptor (GLP-1R) Gene Are Associated with the Risk of Coronary Artery Disease in Chinese Han Patients with Type 2 Diabetes Mellitus: A Case-Control Study.J Diabetes Res. 2018 Sep 9;2018:1054192. doi: 10.1155/2018/1054192. eCollection 2018.
2 Sodium butyrate exerts protective effect against Parkinson's disease in mice via stimulation of glucagon like peptide-1.J Neurol Sci. 2017 Oct 15;381:176-181. doi: 10.1016/j.jns.2017.08.3235. Epub 2017 Aug 24.
3 Addition of glucagon-like peptide-1 receptor agonist therapy to insulin in C-peptide-positive patients with type 1 diabetes.Diabetes Obes Metab. 2019 Apr;21(4):1054-1057. doi: 10.1111/dom.13609. Epub 2019 Jan 8.
4 Genome-wide mapping of histone H3K9me2 in acute myeloid leukemia reveals large chromosomal domains associated with massive gene silencing and sites of genome instability.PLoS One. 2017 Mar 16;12(3):e0173723. doi: 10.1371/journal.pone.0173723. eCollection 2017.
5 Association of glucagon-like peptide-1 receptor agonist use and rates of acute myocardial infarction, stroke and overall mortality in patients with type 2 diabetes mellitus in a large integrated health system.Diabetes Obes Metab. 2017 Nov;19(11):1555-1561. doi: 10.1111/dom.12969. Epub 2017 Jul 5.
6 Pharmacological inhibition of G9a/GLP restores cognition and reduces oxidative stress, neuroinflammation and -Amyloid plaques in an early-onset Alzheimer's disease mouse model.Aging (Albany NY). 2019 Dec 4;11(23):11591-11608. doi: 10.18632/aging.102558. Epub 2019 Dec 4.
7 Evidence of metabolic memory-induced neurodegeneration and the therapeutic effects of glucagon-like peptide-1 receptor agonists via Forkhead box class O.Biochim Biophys Acta Mol Basis Dis. 2019 Feb 1;1865(2):371-377. doi: 10.1016/j.bbadis.2018.11.012. Epub 2018 Nov 20.
8 Liraglutide Attenuates Preestablished Atherosclerosis in Apolipoprotein E-Deficient Mice via Regulation of Immune Cell Phenotypes and Proinflammatory Mediators.J Pharmacol Exp Ther. 2019 Sep;370(3):447-458. doi: 10.1124/jpet.119.258343. Epub 2019 Jul 3.
9 Targeted lipidomics reveal derangement of ceramides in major depression and bipolar disorder.Metabolism. 2019 Jun;95:65-76. doi: 10.1016/j.metabol.2019.04.002. Epub 2019 Apr 5.
10 Series: Implications of the recent CVOTs in type 2 diabetes: Impact on guidelines: The endocrinologist point of view.Diabetes Res Clin Pract. 2020 Jan;159:107726. doi: 10.1016/j.diabres.2019.05.005. Epub 2019 May 18.
11 Review of glucagon-like peptide-1 receptor agonists for the treatment of type 2 diabetes mellitus in patients with chronic kidney disease and their renal effects.J Diabetes. 2019 Dec;11(12):938-948. doi: 10.1111/1753-0407.12969. Epub 2019 Aug 14.
12 Epigenetics and memory: Emerging role of histone lysine methyltransferase G9a/GLP complex as bidirectional regulator of synaptic plasticity.Neurobiol Learn Mem. 2019 Mar;159:1-5. doi: 10.1016/j.nlm.2019.01.013. Epub 2019 Jan 28.
13 GLP-1 receptor agonists for prevention of cardiorenal outcomes in type 2 diabetes: An updated meta-analysis including the REWIND and PIONEER 6 trials.Diabetes Obes Metab. 2019 Nov;21(11):2576-2580. doi: 10.1111/dom.13847. Epub 2019 Aug 28.
14 Glucagon-like Peptide 1 Receptor Agonists, Diabetic Retinopathy and Angiogenesis: The AngioSafe Type 2 Diabetes Study.J Clin Endocrinol Metab. 2020 Apr 1;105(4):dgz069. doi: 10.1210/clinem/dgz069.
15 FIH Is an Oxygen Sensor in Ovarian Cancer for G9a/GLP-Driven Epigenetic Regulation of Metastasis-Related Genes.Cancer Res. 2018 Mar 1;78(5):1184-1199. doi: 10.1158/0008-5472.CAN-17-2506. Epub 2017 Dec 19.
16 Efficacy and safety of glucagon-like peptide-1 receptor agonists in non-alcoholic fatty liver disease: A systematic review and meta-analysis.Clin Res Hepatol Gastroenterol. 2017 Jun;41(3):284-295. doi: 10.1016/j.clinre.2016.11.009. Epub 2017 Jan 5.
17 A nuclear lamina-chromatin-Ran GTPase axis modulates nuclear import and DNA damage signaling.Aging Cell. 2019 Feb;18(1):e12851. doi: 10.1111/acel.12851. Epub 2018 Dec 19.
18 Emerging glucose-lowering therapies: a guide for cardiologists.Heart. 2020 Jan;106(1):18-23. doi: 10.1136/heartjnl-2019-315758. Epub 2019 Sep 24.
19 Preparation of Ganoderma lucidum polysaccharidechromium (III) complex and its hypoglycemic and hypolipidemic activities in high-fat and high-fructose diet-induced pre-diabetic mice.Int J Biol Macromol. 2019 Nov 1;140:782-793. doi: 10.1016/j.ijbiomac.2019.08.072. Epub 2019 Aug 8.
20 68Ga DOTA-Exendin PET/CT for Detection of Insulinoma in a Patient With Persistent Hyperinsulinemic Hypoglycemia.Clin Nucl Med. 2018 Aug;43(8):e285-e286. doi: 10.1097/RLU.0000000000002155.
21 Biochemical validation of EHMT1 missense mutations in Kleefstra syndrome.J Hum Genet. 2018 May;63(5):555-562. doi: 10.1038/s10038-018-0413-3. Epub 2018 Feb 19.
22 Critical review of renal tubule karyomegaly in non-clinical safety evaluation studies and its significance for human risk assessment.Crit Rev Toxicol. 2018 Aug;48(7):575-595. doi: 10.1080/10408444.2018.1503641. Epub 2018 Oct 2.
23 Erratum to: Microvascular effects of glucagon-like peptide-1 receptor agonists in type 2 diabetes: a meta-analysis of randomized controlled trials.Acta Diabetol. 2017 Nov;54(11):1069-1071. doi: 10.1007/s00592-017-1049-z.
24 Inhibition of microRNA-124a attenuates non-alcoholic fatty liver disease through upregulation of adipose triglyceride lipase and the effect of liraglutide intervention.Hepatol Res. 2019 Jul;49(7):743-757. doi: 10.1111/hepr.13330. Epub 2019 Apr 17.
25 An evaluation of liraglutide including its efficacy and safety for the treatment of obesity.Expert Opin Pharmacother. 2020 Feb;21(3):275-285. doi: 10.1080/14656566.2019.1695779. Epub 2019 Dec 2.
26 Novel skeletal effects of glucagon-like peptide-1 (GLP-1) receptor agonists.J Endocrinol. 2018 Jan;236(1):R29-R42. doi: 10.1530/JOE-17-0278. Epub 2017 Aug 30.
27 GLP-1 receptor agonists and risk of cancer in type 2 diabetes: an updated meta-analysis of randomized controlled trials.Endocrine. 2019 Nov;66(2):157-165. doi: 10.1007/s12020-019-02055-z. Epub 2019 Aug 16.
28 Effectiveness of Sodium-Glucose Cotransporter-2 Inhibitor as an Add-on Drug to GLP-1 Receptor Agonists for Glycemic Control of a Patient with Prader-Willi Syndrome: A Case Report.Diabetes Ther. 2018 Feb;9(1):421-426. doi: 10.1007/s13300-018-0369-5. Epub 2018 Jan 15.
29 Glucagon-like peptide-1 receptor agonists are not associated with retinal adverse events in the FDA Adverse Event Reporting System.BMJ Open Diabetes Res Care. 2018 Jan 30;6(1):e000475. doi: 10.1136/bmjdrc-2017-000475. eCollection 2018.
30 Glucagon-like peptide-1 receptor agonists for antipsychotic-associated cardio-metabolic risk factors: A systematic review and individual participant data meta-analysis.Diabetes Obes Metab. 2019 Feb;21(2):293-302. doi: 10.1111/dom.13522. Epub 2018 Oct 7.
31 Navigating the "MACE" in Cardiovascular Outcomes Trials and decoding the relevance of Atherosclerotic Cardiovascular Disease benefits versus Heart Failure benefits.Diabetes Obes Metab. 2019 Aug;21(8):1780-1789. doi: 10.1111/dom.13740. Epub 2019 Apr 29.
32 The Histone Methyltransferase Inhibitor A-366 Uncovers a Role for G9a/GLP in the Epigenetics of Leukemia.PLoS One. 2015 Jul 6;10(7):e0131716. doi: 10.1371/journal.pone.0131716. eCollection 2015.
33 A Review on the Effects of New Anti-Diabetic Drugs on Platelet Function.Endocr Metab Immune Disord Drug Targets. 2020;20(3):328-334. doi: 10.2174/1871530319666191014110414.
34 Treatment with incretins does not increase the risk of pancreatic diseases compared to older anti-hyperglycaemic drugs, when added to metformin: real world evidence in people with Type 2 diabetes.Diabet Med. 2019 Apr;36(4):491-498. doi: 10.1111/dme.13835. Epub 2018 Oct 25.
35 Epigenetic response to environmental stress: Assembly of BRG1-G9a/GLP-DNMT3 repressive chromatin complex on Myh6 promoter in pathologically stressed hearts.Biochim Biophys Acta. 2016 Jul;1863(7 Pt B):1772-81. doi: 10.1016/j.bbamcr.2016.03.002. Epub 2016 Mar 4.
36 Effects of glucose-lowering agents on surrogate endpoints and hard clinical renal outcomes in patients with type 2 diabetes.Diabetes Metab. 2019 Apr;45(2):110-121. doi: 10.1016/j.diabet.2018.10.003. Epub 2018 Oct 25.
37 Future Perspectives on GLP-1 Receptor Agonists and GLP-1/glucagon Receptor Co-agonists in the Treatment of NAFLD.Front Endocrinol (Lausanne). 2018 Nov 6;9:649. doi: 10.3389/fendo.2018.00649. eCollection 2018.
38 Pancreatitis Incidence in the Exenatide BID, Exenatide QW, and Exenatide QW Suspension Development Programs: Pooled Analysis of 35 Clinical Trials.Diabetes Ther. 2019 Aug;10(4):1249-1270. doi: 10.1007/s13300-019-0627-1. Epub 2019 May 10.
39 GLP overexpression is associated with poor prognosis in Chronic Lymphocytic Leukemia and its inhibition induces leukemic cell death.Invest New Drugs. 2018 Oct;36(5):955-960. doi: 10.1007/s10637-018-0613-x. Epub 2018 May 31.
40 Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.