Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJBUVWS)

• DOT Name: Protein c-Fos (FOS)
• Synonyms: Cellular oncogene fos; Fos proto-oncogene, AP-1 transcription factor subunit; G0/G1 switch regulatory protein 7; Proto-oncogene c-Fos; Transcription factor AP-1 subunit c-Fos
• Gene Name: FOS
• Related Disease: Berardinelli-Seip congenital lipodystrophy
• UniProt ID: FOS_HUMAN
• PDB ID: 1A02; 1FOS; 1S9K
• Pfam ID: PF00170
• Sequence:
  MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
  IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
  QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
  TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
  LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
  ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
  GSSSNEPSSDSLSSPTLLAL
• Function: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  MAPK sig.ling pathway (hsa04010)
  cAMP sig.ling pathway (hsa04024)
  Apoptosis (hsa04210)
  Osteoclast differentiation (hsa04380)
  Toll-like receptor sig.ling pathway (hsa04620)
  IL-17 sig.ling pathway (hsa04657)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  T cell receptor sig.ling pathway (hsa04660)
  B cell receptor sig.ling pathway (hsa04662)
  TNF sig.ling pathway (hsa04668)
  Circadian entrainment (hsa04713)
  Cholinergic sy.pse (hsa04725)
  Dopaminergic sy.pse (hsa04728)
  Estrogen sig.ling pathway (hsa04915)
  Prolactin sig.ling pathway (hsa04917)
  Oxytocin sig.ling pathway (hsa04921)
  Relaxin sig.ling pathway (hsa04926)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  Non-alcoholic fatty liver disease (hsa04932)
  Growth hormone synthesis, secretion and action (hsa04935)
  Amphetamine addiction (hsa05031)
  Pathogenic Escherichia coli infection (hsa05130)
  Salmonella infection (hsa05132)
  Pertussis (hsa05133)
  Yersinia infection (hsa05135)
  Leishmaniasis (hsa05140)
  Chagas disease (hsa05142)
  Hepatitis B (hsa05161)
  Measles (hsa05162)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Human immunodeficiency virus 1 infection (hsa05170)
  Coro.virus disease - COVID-19 (hsa05171)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Colorectal cancer (hsa05210)
  Breast cancer (hsa05224)
  Choline metabolism in cancer (hsa05231)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
  Rheumatoid arthritis (hsa05323)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)
  FCERI mediated MAPK activation (R-HSA-2871796)
  Activation of the AP-1 family of transcription factors (R-HSA-450341)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648)
  Estrogen-dependent gene expression (R-HSA-9018519)
  NGF-stimulated transcription (R-HSA-9031628)
  Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638)
  NPAS4 regulates expression of target genes (R-HSA-9768919)
  Oxidative Stress Induced Senescence (R-HSA-2559580)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Berardinelli-Seip congenital lipodystrophy	DISKW75N	Supportive	Autosomal recessive	[1]

This DOT Affected the Drug Response of 8 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ethanol	DMDRQZU	Approved	Protein c-Fos (FOS) increases the Alcohol poisoning ADR of Ethanol.	[80]
Mitomycin	DMH0ZJE	Approved	Protein c-Fos (FOS) affects the response to substance of Mitomycin.	[81]
Levodopa	DMN3E57	Approved	Protein c-Fos (FOS) increases the Adverse drug reaction ADR of Levodopa.	[80]
Carbachol	DMX9K8F	Approved	Protein c-Fos (FOS) increases the Seizure ADR of Carbachol.	[80]
Penicillin V	DMKVOYF	Approved	Protein c-Fos (FOS) increases the Depression ADR of Penicillin V.	[80]
Chloroxine	DMFZBMQ	Approved	Protein c-Fos (FOS) increases the Apoptosis ADR of Chloroxine.	[80]
Apomorphine	DMX38HQ	Approved	Protein c-Fos (FOS) increases the Adverse drug reaction ADR of Apomorphine.	[80]
Dizocilpine	DMMGYXR	Terminated	Protein c-Fos (FOS) increases the Depression ADR of Dizocilpine.	[80]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein c-Fos (FOS).	[2]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Protein c-Fos (FOS).	[77]

97 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein c-Fos (FOS).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein c-Fos (FOS).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein c-Fos (FOS).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein c-Fos (FOS).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein c-Fos (FOS).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein c-Fos (FOS).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein c-Fos (FOS).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Protein c-Fos (FOS).	[10]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Protein c-Fos (FOS).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Protein c-Fos (FOS).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Protein c-Fos (FOS).	[13]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein c-Fos (FOS).	[14]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein c-Fos (FOS).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein c-Fos (FOS).	[16]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Protein c-Fos (FOS).	[17]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Protein c-Fos (FOS).	[18]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Protein c-Fos (FOS).	[19]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Protein c-Fos (FOS).	[20]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Protein c-Fos (FOS).	[21]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Protein c-Fos (FOS).	[22]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Protein c-Fos (FOS).	[23]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Protein c-Fos (FOS).	[24]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Protein c-Fos (FOS).	[25]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Protein c-Fos (FOS).	[26]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Protein c-Fos (FOS).	[27]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Protein c-Fos (FOS).	[28]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Protein c-Fos (FOS).	[29]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Protein c-Fos (FOS).	[30]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Protein c-Fos (FOS).	[31]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Protein c-Fos (FOS).	[32]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Protein c-Fos (FOS).	[33]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Protein c-Fos (FOS).	[34]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Protein c-Fos (FOS).	[35]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Protein c-Fos (FOS).	[36]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Protein c-Fos (FOS).	[37]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Protein c-Fos (FOS).	[38]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of Protein c-Fos (FOS).	[39]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Protein c-Fos (FOS).	[40]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the expression of Protein c-Fos (FOS).	[41]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of Protein c-Fos (FOS).	[42]
Fluoxetine	DM3PD2C	Approved	Fluoxetine decreases the expression of Protein c-Fos (FOS).	[43]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Protein c-Fos (FOS).	[44]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Protein c-Fos (FOS).	[45]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Protein c-Fos (FOS).	[46]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the expression of Protein c-Fos (FOS).	[47]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Protein c-Fos (FOS).	[48]
Ardeparin	DMYRX8B	Approved	Ardeparin increases the expression of Protein c-Fos (FOS).	[49]
Morphine	DMRMS0L	Approved	Morphine increases the expression of Protein c-Fos (FOS).	[50]
Josamycin	DMKJ8LB	Approved	Josamycin increases the expression of Protein c-Fos (FOS).	[51]
Mebendazole	DMO14SG	Approved	Mebendazole increases the expression of Protein c-Fos (FOS).	[34]
Clotrimazole	DMMFCIH	Approved	Clotrimazole decreases the expression of Protein c-Fos (FOS).	[52]
Nilotinib	DM7HXWT	Approved	Nilotinib increases the expression of Protein c-Fos (FOS).	[53]
Sodium chloride	DMM3950	Approved	Sodium chloride increases the expression of Protein c-Fos (FOS).	[54]
Allopurinol	DMLPAOB	Approved	Allopurinol increases the expression of Protein c-Fos (FOS).	[34]
Erythromycin	DM4K7GQ	Approved	Erythromycin increases the expression of Protein c-Fos (FOS).	[51]
Flecainide	DMSQDLE	Approved	Flecainide increases the expression of Protein c-Fos (FOS).	[34]
Amphetamine	DMSZQAK	Approved	Amphetamine increases the expression of Protein c-Fos (FOS).	[55]
Promegestone	DMK4S8I	Approved	Promegestone increases the expression of Protein c-Fos (FOS).	[56]
Dipyridamole	DMXY30O	Approved	Dipyridamole increases the expression of Protein c-Fos (FOS).	[34]
Amiloride	DMRTSGP	Approved	Amiloride increases the expression of Protein c-Fos (FOS).	[34]
Clarithromycin	DM4M1SG	Approved	Clarithromycin increases the expression of Protein c-Fos (FOS).	[51]
Pyrimethamine	DM5X7VY	Approved	Pyrimethamine increases the expression of Protein c-Fos (FOS).	[34]
Fotemustine	DMV62ED	Approved	Fotemustine increases the expression of Protein c-Fos (FOS).	[57]
Nimodipine	DMQ0RKZ	Approved	Nimodipine increases the expression of Protein c-Fos (FOS).	[34]
Diflunisal	DM7EN8I	Approved	Diflunisal increases the expression of Protein c-Fos (FOS).	[34]
Phytonadione	DM8HDOL	Approved	Phytonadione increases the expression of Protein c-Fos (FOS).	[21]
Nabumetone	DMAT2XH	Approved	Nabumetone increases the expression of Protein c-Fos (FOS).	[34]
Zithromax	DMN4H2O	Approved	Zithromax increases the expression of Protein c-Fos (FOS).	[51]
Chlorpropamide	DMPHZQE	Approved	Chlorpropamide increases the expression of Protein c-Fos (FOS).	[34]
Acebutolol	DM0TI4U	Approved	Acebutolol increases the expression of Protein c-Fos (FOS).	[34]
Ephedrine	DMMV0KW	Approved	Ephedrine increases the expression of Protein c-Fos (FOS).	[34]
Acrivastine	DMTIGA0	Approved	Acrivastine increases the expression of Protein c-Fos (FOS).	[34]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein c-Fos (FOS).	[58]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Protein c-Fos (FOS).	[59]
Beclomethasone dipropionate	DM5NW1E	Phase 4	Beclomethasone dipropionate decreases the expression of Protein c-Fos (FOS).	[60]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Protein c-Fos (FOS).	[61]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Protein c-Fos (FOS).	[62]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the activity of Protein c-Fos (FOS).	[63]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Protein c-Fos (FOS).	[64]
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of Protein c-Fos (FOS).	[65]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Protein c-Fos (FOS).	[11]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Protein c-Fos (FOS).	[66]
Verapamil	DMA7PEW	Phase 2/3 Trial	Verapamil increases the expression of Protein c-Fos (FOS).	[34]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Protein c-Fos (FOS).	[67]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Protein c-Fos (FOS).	[23]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Protein c-Fos (FOS).	[68]
Puerarin	DMJIMXH	Phase 2	Puerarin increases the expression of Protein c-Fos (FOS).	[69]
Lithium	DMZ3OU6	Phase 2	Lithium increases the expression of Protein c-Fos (FOS).	[70]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Protein c-Fos (FOS).	[71]
G1	DMTV42K	Phase 1/2	G1 decreases the expression of Protein c-Fos (FOS).	[72]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein c-Fos (FOS).	[74]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein c-Fos (FOS).	[75]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Protein c-Fos (FOS).	[76]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Protein c-Fos (FOS).	[71]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the activity of Protein c-Fos (FOS).	[78]
PMID28870136-Compound-49	DMTUC9E	Patented	PMID28870136-Compound-49 increases the expression of Protein c-Fos (FOS).	[79]
Roxithromycin	DMVMIK2	Withdrawn from market	Roxithromycin increases the expression of Protein c-Fos (FOS).	[51]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PIPERINE	DMYEAB1	Phase 1/2	PIPERINE decreases the localization of Protein c-Fos (FOS).	[73]

References

• [1] A mutation in the c-fos gene associated with congenital generalized lipodystrophy. Orphanet J Rare Dis. 2013 Aug 7;8:119. doi: 10.1186/1750-1172-8-119.
• [2] Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Sensitization of cervical cancer cell lines to low-dose radiation by retinoic acid does not require functional p53. Gynecol Oncol. 2005 Apr;97(1):142-50. doi: 10.1016/j.ygyno.2004.12.034.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Bisphenol A at the reference level counteracts doxorubicin transcriptional effects on cancer related genes in HT29 cells. Toxicol In Vitro. 2015 Dec;29(8):2009-14. doi: 10.1016/j.tiv.2015.08.016. Epub 2015 Aug 28.
• [7] Differential metal response and regulation of human heavy metal-inducible genes. J Cell Physiol. 1999 Jul;180(1):105-13.
• [8] Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
• [9] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [10] Effects of arsenic, cadmium, chromium, and lead on gene expression regulated by a battery of 13 different promoters in recombinant HepG2 cells. Toxicol Appl Pharmacol. 2000 Oct 15;168(2):79-90.
• [11] The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells. J Biol Chem. 2004 Jun 25;279(26):27008-16. doi: 10.1074/jbc.M403588200. Epub 2004 Apr 16.
• [12] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [13] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [14] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [15] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [16] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [17] Methotrexate induces production of IL-1 and IL-6 in the monocytic cell line U937. Arthritis Res Ther. 2014 Jan 20;16(1):R17. doi: 10.1186/ar4444.
• [18] Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
• [19] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [20] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [21] Effect of cell differentiation for neuroblastoma by vitamin k analogs. Jpn J Clin Oncol. 2009 Apr;39(4):251-9. doi: 10.1093/jjco/hyp011. Epub 2009 Mar 8.
• [22] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [23] Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
• [24] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [25] Folic acid modulates cancer-associated micro RNAs and inflammatory mediators in neoplastic and non-neoplastic colonic cells in a different way. Mol Nutr Food Res. 2017 Dec;61(12). doi: 10.1002/mnfr.201700260. Epub 2017 Nov 9.
• [26] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [27] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [28] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [29] Survival of retinal pigment epithelium after exposure to prolonged oxidative injury: a detailed gene expression and cellular analysis. Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3767-77.
• [30] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [31] Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
• [32] (-)-Xanthatin induces the prolonged expression of c-Fos through an N-acetyl-L-cysteine (NAC)-sensitive mechanism in human breast cancer MDA-MB-231 cells. J Toxicol Sci. 2013;38(4):547-57. doi: 10.2131/jts.38.547.
• [33] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [34] Selection of drugs to test the specificity of the Tg.AC assay by screening for induction of the gadd153 promoter in vitro. Toxicol Sci. 2003 Aug;74(2):260-70. doi: 10.1093/toxsci/kfg113. Epub 2003 May 2.
• [35] Nicotine treatment induces expression of matrix metalloproteinases in human osteoblastic Saos-2 cells. Acta Biochim Biophys Sin (Shanghai). 2006 Dec;38(12):874-82. doi: 10.1111/j.1745-7270.2006.00240.x.
• [36] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [37] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [38] Dopamine transporter-dependent induction of C-Fos in HEK cells. Synapse. 2002 Jul;45(1):52-65. doi: 10.1002/syn.10084.
• [39] Simvastatin inhibits NOR-1 expression induced by hyperlipemia by interfering with CREB activation. Cardiovasc Res. 2005 Aug 1;67(2):333-41. doi: 10.1016/j.cardiores.2005.03.016. Epub 2005 Apr 21.
• [40] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [41] Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
• [42] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [43] Fluoxetine inhibits the extracellular signal regulated kinase pathway and suppresses growth of cancer cells. Cancer Biol Ther. 2008 Oct;7(10):1685-93. doi: 10.4161/cbt.7.10.6664. Epub 2008 Oct 22.
• [44] Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
• [45] The HIV protease inhibitor ritonavir synergizes with butyrate for induction of apoptotic cell death and mediates expression of heme oxygenase-1 in DLD-1 colon carcinoma cells. Br J Pharmacol. 2004 Dec;143(7):890-8. doi: 10.1038/sj.bjp.0706023. Epub 2004 Oct 25.
• [46] Involvement of mitochondrial dysfunction in nefazodone-induced hepatotoxicity. Food Chem Toxicol. 2016 Aug;94:148-58. doi: 10.1016/j.fct.2016.06.001. Epub 2016 Jun 8.
• [47] Prostaglandin E2 and the protein kinase A pathway mediate arachidonic acid induction of c-fos in human prostate cancer cells. Br J Cancer. 2000 Jun;82(12):2000-6. doi: 10.1054/bjoc.2000.1143.
• [48] Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
• [49] Heparin binding and oligomerization of hepatocyte growth factor/scatter factor isoforms. Heparan sulfate glycosaminoglycan requirement for Met binding and signaling. J Biol Chem. 1997 Apr 4;272(14):9457-63. doi: 10.1074/jbc.272.14.9457.
• [50] Mechanisms of the inhibition of nuclear factor-B by morphine in neuronal cells. Mol Pharmacol. 2012 Apr;81(4):587-97. doi: 10.1124/mol.111.076620. Epub 2012 Jan 18.
• [51] Liver toxicity of macrolide antibiotics in zebrafish. Toxicology. 2020 Aug;441:152501. doi: 10.1016/j.tox.2020.152501. Epub 2020 May 23.
• [52] Effects of clotrimazole on the growth, morphological characteristics, and cisplatin sensitivity of human glioblastoma cells in vitro. J Neurosurg. 1999 May;90(5):918-27. doi: 10.3171/jns.1999.90.5.0918.
• [53] Endoplasmic reticulum stress-mediated apoptosis in imatinib-resistant leukemic K562-r cells triggered by AMN107 combined with arsenic trioxide. Exp Biol Med (Maywood). 2013 Aug 1;238(8):932-42. doi: 10.1177/1535370213492689. Epub 2013 Jul 24.
• [54] Neoplastic-like transformation effect of single-walled and multi-walled carbon nanotubes compared to asbestos on human lung small airway epithelial cells. Nanotoxicology. 2014 Aug;8(5):485-507.
• [55] Effect of acute and chronic psychostimulant drugs on redox status, AP-1 activation and pro-enkephalin mRNA in the human astrocyte-like U373 MG cells. Neuropharmacology. 2005 Apr;48(5):673-84. doi: 10.1016/j.neuropharm.2004.12.010.
• [56] Two chromatin remodeling activities cooperate during activation of hormone responsive promoters. PLoS Genet. 2009 Jul;5(7):e1000567. doi: 10.1371/journal.pgen.1000567. Epub 2009 Jul 17.
• [57] Human three prime exonuclease TREX1 is induced by genotoxic stress and involved in protection of glioma and melanoma cells to anticancer drugs. Biochim Biophys Acta. 2013 Aug;1833(8):1832-43. doi: 10.1016/j.bbamcr.2013.03.029. Epub 2013 Apr 8.
• [58] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [59] Changes in androgen receptor nongenotropic signaling correlate with transition of LNCaP cells to androgen independence. Cancer Res. 2004 Oct 1;64(19):7156-68. doi: 10.1158/0008-5472.CAN-04-1121.
• [60] Glucocorticoids decrease c-fos expression in human nasal polyps in vivo. Thorax. 1998 Jul;53(7):577-82. doi: 10.1136/thx.53.7.577.
• [61] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [62] Structure-activity relationships of resveratrol and derivatives in breast cancer cells. Mol Nutr Food Res. 2009 Jul;53(7):845-58. doi: 10.1002/mnfr.200800331.
• [63] Resveratrol-induced modification of polyamine metabolism is accompanied by induction of c-Fos. Carcinogenesis. 2003 Mar;24(3):469-74. doi: 10.1093/carcin/24.3.469.
• [64] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [65] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [66] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [67] Upregulation of genes orchestrating keratinocyte differentiation, including the novel marker gene ID2, by contact sensitizers in human bulge-derived keratinocytes. J Biochem Mol Toxicol. 2010 Jan-Feb;24(1):10-20.
• [68] Quercetin inhibits inducible ICAM-1 expression in human endothelial cells through the JNK pathway. Am J Physiol. 1999 Sep;277(3):C403-11. doi: 10.1152/ajpcell.1999.277.3.C403.
• [69] Intestinal bacteria activate estrogenic effect of main constituents puerarin and daidzin of Pueraria thunbergiana. Biol Pharm Bull. 2006 Dec;29(12):2432-5. doi: 10.1248/bpb.29.2432.
• [70] A genetic network model of cellular responses to lithium treatment and cocaine abuse in bipolar disorder. BMC Syst Biol. 2010 Nov 19;4:158. doi: 10.1186/1752-0509-4-158.
• [71] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [72] Morphologic effects of estrogen stimulation on 3D MCF-7 microtissues. Toxicol Lett. 2016 Apr 25;248:1-8.
• [73] Piperine is a potent inhibitor of nuclear factor-kappaB (NF-kappaB), c-Fos, CREB, ATF-2 and proinflammatory cytokine gene expression in B16F-10 melanoma cells. Int Immunopharmacol. 2004 Dec 20;4(14):1795-803. doi: 10.1016/j.intimp.2004.08.005.
• [74] A role of aryl hydrocarbon receptor in the antiandrogenic effects of polycyclic aromatic hydrocarbons in LNCaP human prostate carcinoma cells. Arch Toxicol. 2003 Jun;77(6):335-43. doi: 10.1007/s00204-003-0454-y. Epub 2003 Mar 12.
• [75] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [76] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [77] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [78] Luteolin, a flavonoid, inhibits AP-1 activation by basophils. Biochem Biophys Res Commun. 2006 Feb 3;340(1):1-7. doi: 10.1016/j.bbrc.2005.11.157. Epub 2005 Dec 6.
• [79] Pentoxifylline induces apoptosis in vitro in cutaneous T cell lymphoma (HuT-78) and enhances FasL mediated killing by upregulating Fas expression. Biochem Pharmacol. 2009 Jan 1;77(1):30-45. doi: 10.1016/j.bcp.2008.09.018. Epub 2008 Sep 21.
• [80] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [81] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.