Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK5WSFI)

DOT Name Regulator of microtubule dynamics protein 2 (RMDN2)
Synonyms RMD-2; hRMD-2; Protein FAM82A1
Gene Name RMDN2
Related Disease
Rheumatoid arthritis ( )
Acute lymphocytic leukaemia ( )
Acute myelogenous leukaemia ( )
Adult glioblastoma ( )
Alzheimer disease ( )
Autism spectrum disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cardiac failure ( )
Chronic kidney disease ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal neoplasm ( )
Congestive heart failure ( )
Diabetic kidney disease ( )
Endometriosis ( )
Epilepsy ( )
Frontotemporal dementia ( )
Glioblastoma multiforme ( )
Glioma ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Melanoma ( )
Multiple sclerosis ( )
Myocardial infarction ( )
Neoplasm ( )
Nervous system inflammation ( )
Non-small-cell lung cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Systemic lupus erythematosus ( )
Tauopathy ( )
Triple negative breast cancer ( )
Cutaneous melanoma ( )
Epithelial ovarian cancer ( )
Parkinson disease ( )
Squamous cell carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Advanced cancer ( )
B-cell neoplasm ( )
Hepatitis C virus infection ( )
High blood pressure ( )
Nasopharyngeal carcinoma ( )
Osteoarthritis ( )
Pancreatic cancer ( )
Thyroid gland papillary carcinoma ( )
Type-1 diabetes ( )
Type-1/2 diabetes ( )
UniProt ID
RMD2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF21033
Sequence
MPYSTNKELILGIMVGTAGISLLLLWYHKVRKPGIAMKLPEFLSLGNTFNSITLQDEIHD
DQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKI
SPQHRARKRRLPTIQSSATSNSSEEAESEGGYITANTDTEEQSFPVPKAFNTRVEELNLD
VLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKKHY
ANIGKTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLP
EEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAEELCPGYSNPN
YMYLAKCYTDLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Rheumatoid arthritis DISTSB4J Definitive Biomarker [1]
Acute lymphocytic leukaemia DISPX75S Strong Altered Expression [2]
Acute myelogenous leukaemia DISCSPTN Strong Altered Expression [2]
Adult glioblastoma DISVP4LU Strong Altered Expression [3]
Alzheimer disease DISF8S70 Strong Biomarker [4]
Autism spectrum disorder DISXK8NV Strong Biomarker [5]
Breast cancer DIS7DPX1 Strong Altered Expression [6]
Breast carcinoma DIS2UE88 Strong Altered Expression [6]
Breast neoplasm DISNGJLM Strong Altered Expression [7]
Cardiac failure DISDC067 Strong Biomarker [8]
Chronic kidney disease DISW82R7 Strong Altered Expression [9]
Colon cancer DISVC52G Strong Altered Expression [10]
Colon carcinoma DISJYKUO Strong Altered Expression [10]
Colorectal neoplasm DISR1UCN Strong Altered Expression [11]
Congestive heart failure DIS32MEA Strong Biomarker [8]
Diabetic kidney disease DISJMWEY Strong Genetic Variation [12]
Endometriosis DISX1AG8 Strong Biomarker [13]
Epilepsy DISBB28L Strong Biomarker [14]
Frontotemporal dementia DISKYHXL Strong Biomarker [15]
Glioblastoma multiforme DISK8246 Strong Altered Expression [3]
Glioma DIS5RPEH Strong Altered Expression [16]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [17]
Lung adenocarcinoma DISD51WR Strong Genetic Variation [18]
Melanoma DIS1RRCY Strong Genetic Variation [19]
Multiple sclerosis DISB2WZI Strong Biomarker [20]
Myocardial infarction DIS655KI Strong Biomarker [21]
Neoplasm DISZKGEW Strong Biomarker [22]
Nervous system inflammation DISB3X5A Strong Biomarker [23]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [24]
Prostate cancer DISF190Y Strong Biomarker [25]
Prostate carcinoma DISMJPLE Strong Biomarker [25]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [23]
Tauopathy DISY2IPA Strong Biomarker [26]
Triple negative breast cancer DISAMG6N Strong Biomarker [27]
Cutaneous melanoma DIS3MMH9 moderate Genetic Variation [28]
Epithelial ovarian cancer DIS56MH2 moderate Biomarker [29]
Parkinson disease DISQVHKL moderate Biomarker [23]
Squamous cell carcinoma DISQVIFL moderate Altered Expression [30]
Childhood acute lymphoblastic leukemia DISJ5D6U Disputed Altered Expression [2]
Advanced cancer DISAT1Z9 Limited Altered Expression [31]
B-cell neoplasm DISVY326 Limited Altered Expression [32]
Hepatitis C virus infection DISQ0M8R Limited Biomarker [33]
High blood pressure DISY2OHH Limited Biomarker [34]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [35]
Osteoarthritis DIS05URM Limited Biomarker [36]
Pancreatic cancer DISJC981 Limited Altered Expression [37]
Thyroid gland papillary carcinoma DIS48YMM Limited Biomarker [38]
Type-1 diabetes DIS7HLUB Limited Biomarker [39]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [41]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [42]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [43]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [44]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [45]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [46]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [47]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [48]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Regulator of microtubule dynamics protein 2 (RMDN2). [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Regulator of microtubule dynamics protein 2 (RMDN2). [49]
------------------------------------------------------------------------------------

References

1 Arsenic Trioxide in Synergy with Vitamin D Rescues the Defective VDR-PPAR- Functional Module of Autophagy in Rheumatoid Arthritis.PPAR Res. 2019 May 7;2019:6403504. doi: 10.1155/2019/6403504. eCollection 2019.
2 Beclin-1 and hypoxia-inducible factor-1 genes expression: Potential biomarkers in acute leukemia patients.Cancer Biomark. 2016 Mar 18;16(4):619-26. doi: 10.3233/CBM-160603.
3 Sinomenine Hydrochloride Inhibits the Metastasis of Human Glioblastoma Cells by Suppressing the Expression of Matrix Metalloproteinase-2/-9 and Reversing the Endogenous and Exogenous Epithelial-Mesenchymal Transition.Int J Mol Sci. 2018 Mar 14;19(3):844. doi: 10.3390/ijms19030844.
4 Effect of site-specific amino acid D-isomerization on -sheet transition and fibril formation profiles of Tau microtubule-binding repeat peptides.Biochem Biophys Res Commun. 2019 Jan 1;508(1):184-190. doi: 10.1016/j.bbrc.2018.11.043. Epub 2018 Nov 22.
5 Role of Microtubule-Associated Protein in Autism Spectrum Disorder.Neurosci Bull. 2018 Dec;34(6):1119-1126. doi: 10.1007/s12264-018-0246-2. Epub 2018 Jun 23.
6 High-mobility group box 1 released by autophagic cancer-associated fibroblasts maintains the stemness of luminal breast cancer cells.J Pathol. 2017 Nov;243(3):376-389. doi: 10.1002/path.4958. Epub 2017 Sep 21.
7 Improving breast cancer sensitivity to paclitaxel by increasing aneuploidy.Proc Natl Acad Sci U S A. 2019 Nov 19;116(47):23691-23697. doi: 10.1073/pnas.1910824116. Epub 2019 Nov 4.
8 Ultrastructure and regulation of lateralized connexin43 in the failing heart.Circ Res. 2010 Apr 2;106(6):1153-63. doi: 10.1161/CIRCRESAHA.108.182147. Epub 2010 Feb 18.
9 Hyperphosphatemia induces protective autophagy in endothelial cells through the inhibition of Akt/mTOR signaling.J Vasc Surg. 2015 Jul;62(1):210-221.e2. doi: 10.1016/j.jvs.2014.02.040. Epub 2014 May 3.
10 TPX2 is a novel prognostic marker for the growth and metastasis of colon cancer.J Transl Med. 2013 Dec 17;11:313. doi: 10.1186/1479-5876-11-313.
11 Expression of the microtubule-associated protein MAP9/ASAP and its partners AURKA and PLK1 in colorectal and breast cancers.Dis Markers. 2014;2014:798170. doi: 10.1155/2014/798170. Epub 2014 Apr 30.
12 Evaluation of urinary autophagy transcripts expression in diabetic kidney disease.J Diabetes Complications. 2017 Oct;31(10):1491-1498. doi: 10.1016/j.jdiacomp.2017.06.009. Epub 2017 Jun 27.
13 Expression and significance of autophagy genes LC3, Beclin1 and MMP-2 in endometriosis.Exp Ther Med. 2018 Sep;16(3):1958-1962. doi: 10.3892/etm.2018.6362. Epub 2018 Jun 27.
14 Tau Related Pathways as a Connecting Link between Epilepsy and Alzheimer's Disease.ACS Chem Neurosci. 2019 Oct 16;10(10):4199-4212. doi: 10.1021/acschemneuro.9b00460. Epub 2019 Sep 30.
15 Tau in neurodegenerative disease.Ann Transl Med. 2018 May;6(10):175. doi: 10.21037/atm.2018.04.23.
16 AMPK-dependent autophagy upregulation serves as a survival mechanism in response to Tumor Treating Fields (TTFields).Cell Death Dis. 2018 Oct 19;9(11):1074. doi: 10.1038/s41419-018-1085-9.
17 Suppressor of hepatocellular carcinoma RASSF1A activates autophagy initiation and maturation.Cell Death Differ. 2019 Aug;26(8):1379-1395. doi: 10.1038/s41418-018-0211-7. Epub 2018 Oct 12.
18 The human Bcl-2 family member Bcl-rambo and voltage-dependent anion channels manifest a genetic interaction in Drosophila and cooperatively promote the activation of effector caspases in human cultured cells.Exp Cell Res. 2019 Aug 15;381(2):223-234. doi: 10.1016/j.yexcr.2019.05.015. Epub 2019 May 15.
19 Two-stage genome-wide association study identifies a novel susceptibility locus associated with melanoma.Oncotarget. 2017 Mar 14;8(11):17586-17592. doi: 10.18632/oncotarget.15230.
20 Sex-specific Tau methylation patterns and synaptic transcriptional alterations are associated with neural vulnerability during chronic neuroinflammation.J Autoimmun. 2019 Jul;101:56-69. doi: 10.1016/j.jaut.2019.04.003. Epub 2019 Apr 19.
21 Alterations of autophagic-lysosomal system in the peripheral leukocytes of patients with myocardial infarction.Clin Chim Acta. 2011 Aug 17;412(17-18):1567-71. doi: 10.1016/j.cca.2011.05.002. Epub 2011 May 7.
22 Dual-functionality of RASSF1A overexpression in A375 cells is mediated by activation of IL-6/STAT3 regulatory loop.Mol Biol Rep. 2018 Oct;45(5):1277-1287. doi: 10.1007/s11033-018-4288-3. Epub 2018 Aug 3.
23 Autophagy: a potential key contributor to the therapeutic action of mesenchymal stem cells.Autophagy. 2020 Jan;16(1):28-37. doi: 10.1080/15548627.2019.1630223. Epub 2019 Jun 18.
24 AZD9291 promotes autophagy and inhibits PI3K/Akt pathway in NSCLC cancer cells. J Cell Biochem. 2019 Jan;120(1):756-767. doi: 10.1002/jcb.27434. Epub 2018 Aug 26.
25 A novel role for MAP1 LC3 in nonautophagic cytoplasmic vacuolation death of cancer cells.Oncogene. 2009 Jul 16;28(28):2556-68. doi: 10.1038/onc.2009.118. Epub 2009 May 18.
26 Why Microtubules Should Be Considered as One of the Supplementary Targets for Designing Neurotherapeutics.ACS Chem Neurosci. 2019 Mar 20;10(3):1118-1120. doi: 10.1021/acschemneuro.9b00002. Epub 2019 Jan 18.
27 Large miRNA survival analysis reveals a prognostic four-biomarker signature for triple negative breast cancer.Genet Mol Biol. 2020 Mar 2;43(1):e20180269. doi: 10.1590/1678-4685-GMB-2018-0269. eCollection 2020.
28 Genome-wide meta-analysis identifies five new susceptibility loci for cutaneous malignant melanoma.Nat Genet. 2015 Sep;47(9):987-995. doi: 10.1038/ng.3373. Epub 2015 Aug 3.
29 Decreased expression of autophagy-related proteins in malignant epithelial ovarian cancer.Autophagy. 2008 Nov;4(8):1067-8. doi: 10.4161/auto.6827. Epub 2008 Nov 20.
30 Overexpression of the receptor for hyaluronan-mediated motility, correlates with expression of microtubule-associated protein in human oral squamous cell carcinomas.Int J Oncol. 2009 Jun;34(6):1565-71. doi: 10.3892/ijo_00000286.
31 The prognostic value of theTau protein serum level in metastatic breast cancer patients and its correlation with brain metastases.BMC Cancer. 2019 Jan 30;19(1):110. doi: 10.1186/s12885-019-5287-z.
32 Streptozotocin-Induced Autophagy Reduces Intracellular Insulin in Insulinoma INS-1E Cells.DNA Cell Biol. 2018 Mar;37(3):160-167. doi: 10.1089/dna.2017.3874. Epub 2018 Feb 27.
33 Autophagy protects cells from HCV-induced defects in lipid metabolism.Gastroenterology. 2012 Mar;142(3):644-653.e3. doi: 10.1053/j.gastro.2011.11.033. Epub 2011 Dec 7.
34 Pharmacological restoration of autophagy reduces hypertension-related stroke occurrence.Autophagy. 2020 Aug;16(8):1468-1481. doi: 10.1080/15548627.2019.1687215. Epub 2019 Nov 12.
35 Prognostic value of TIGAR and LC3B protein expression in nasopharyngeal carcinoma.Cancer Manag Res. 2018 Nov 12;10:5605-5616. doi: 10.2147/CMAR.S175501. eCollection 2018.
36 Autophagy promotes citrullination of VIM (vimentin) and its interaction with major histocompatibility complex class II in synovial fibroblasts.Autophagy. 2020 May;16(5):946-955. doi: 10.1080/15548627.2019.1664144. Epub 2019 Sep 8.
37 Autophagy Is Required for Activation of Pancreatic Stellate Cells, Associated With Pancreatic Cancer Progression and Promotes Growth of Pancreatic Tumors in Mice.Gastroenterology. 2017 May;152(6):1492-1506.e24. doi: 10.1053/j.gastro.2017.01.010. Epub 2017 Jan 23.
38 Expression of autophagy-associated proteins in papillary thyroid carcinoma.Oncol Lett. 2017 Jul;14(1):411-415. doi: 10.3892/ol.2017.6101. Epub 2017 Apr 28.
39 Recurrent nonsevere hypoglycemia exacerbates imbalance of mitochondrial homeostasis leading to synapse injury and cognitive deficit in diabetes.Am J Physiol Endocrinol Metab. 2018 Nov 1;315(5):E973-E986. doi: 10.1152/ajpendo.00133.2018. Epub 2018 Jul 3.
40 Lycium barbarum polysaccharide protects diabetic peripheral neuropathy by enhancing autophagy via mTOR/p70S6K inhibition in Streptozotocin-induced diabetic rats.J Chem Neuroanat. 2018 Apr;89:37-42. doi: 10.1016/j.jchemneu.2017.12.011. Epub 2017 Dec 30.
41 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
42 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
43 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
44 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
45 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
46 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
47 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
48 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
49 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.