General Information of Drug Off-Target (DOT) (ID: OTKWCV80)

DOT Name E3 ubiquitin-protein ligase RNF19A (RNF19A)
Synonyms EC 2.3.2.31; Double ring-finger protein; Dorfin; RING finger protein 19A; p38
Gene Name RNF19A
Related Disease
Lung cancer ( )
Lung carcinoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Arteriosclerosis ( )
Arthritis ( )
Atherosclerosis ( )
B-cell neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Chronic obstructive pulmonary disease ( )
Colon cancer ( )
Colon carcinoma ( )
Congestive heart failure ( )
Diabetic kidney disease ( )
Endometriosis ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Hyperglycemia ( )
Melanoma ( )
Myelodysplastic syndrome ( )
Myocardial infarction ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Obesity ( )
Osteoarthritis ( )
Parkinson disease ( )
Plasma cell myeloma ( )
Pneumonia ( )
Pneumonitis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rheumatoid arthritis ( )
Cardiac failure ( )
Colorectal carcinoma ( )
leukaemia ( )
Leukemia ( )
Lung adenocarcinoma ( )
Nervous system inflammation ( )
Neuralgia ( )
Non-insulin dependent diabetes ( )
Pancreatic cancer ( )
Tuberculosis ( )
Osteosarcoma ( )
Bone osteosarcoma ( )
Neuroblastoma ( )
Type-1/2 diabetes ( )
UniProt ID
RN19A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.31
Pfam ID
PF01485
Sequence
MQEQEIGFISKYNEGLCVNTDPVSILTSILDMSLHRQMGSDRDLQSSASSVSLPSVKKAP
KKRRISIGSLFRRKKDNKRKSRELNGGVDGIASIESIHSEMCTDKNSIFSTNTSSDNGLT
SISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCLRQYLRIEISESRVNISCPECT
ERFNPHDIRLILSDDVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKLT
CGREGCGTEFCYHCKQIWHPNQTCDAARQERAQSLRLRTIRSSSISYSQESGAAADDIKP
CPRCAAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKK
ILWQLGTLVGAPVGIALIAGIAIPAMIIGIPVYVGRKIHNRYEGKDVSKHKRNLAIAGGV
TLSVIVSPVVAAVTVGIGVPIMLAYVYGVVPISLCRSGGCGVSAGNGKGVRIEFDDENDI
NVGGTNTAVDTTSVAEARHNPSIGEGSVGGLTGSLSASGSHMDRIGAIRDNLSETASTMA
LAGASITGSLSGSAMVNCFNRLEVQADVQKERYSLSGESGTVSLGTVSDNASTKAMAGSI
LNSYIPLDKEGNSMEVQVDIESKPSKFRHNSGSSSVDDGSATRSHAGGSSSGLPEGKSSA
TKWSKEATAGKKSKSGKLRKKGNMKINETREDMDAQLLEQQSTNSSEFEAPSLSDSMPSV
ADSHSSHFSEFSCSDLESMKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVV
TQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTEI
Function
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates, such as SNCAIP or CASR. Specifically ubiquitinates pathogenic SOD1 variants, which leads to their proteasomal degradation and to neuronal protection.
Tissue Specificity Widely expressed, with highest levels in heart. Ubiquitously expressed in the central nervous system.
Reactome Pathway
Antigen processing (R-HSA-983168 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung cancer DISCM4YA Definitive Biomarker [1]
Lung carcinoma DISTR26C Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Alzheimer disease DISF8S70 Strong Biomarker [3]
Amyotrophic lateral sclerosis DISF7HVM Strong Biomarker [4]
Arteriosclerosis DISK5QGC Strong Altered Expression [5]
Arthritis DIST1YEL Strong Biomarker [6]
Atherosclerosis DISMN9J3 Strong Altered Expression [5]
B-cell neoplasm DISVY326 Strong Posttranslational Modification [7]
Breast cancer DIS7DPX1 Strong Altered Expression [8]
Breast carcinoma DIS2UE88 Strong Altered Expression [8]
Chronic obstructive pulmonary disease DISQCIRF Strong Altered Expression [9]
Colon cancer DISVC52G Strong Biomarker [10]
Colon carcinoma DISJYKUO Strong Biomarker [10]
Congestive heart failure DIS32MEA Strong Altered Expression [11]
Diabetic kidney disease DISJMWEY Strong Biomarker [12]
Endometriosis DISX1AG8 Strong Altered Expression [13]
Glioma DIS5RPEH Strong Altered Expression [14]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [15]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [16]
Hyperglycemia DIS0BZB5 Strong Biomarker [17]
Melanoma DIS1RRCY Strong Biomarker [18]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [19]
Myocardial infarction DIS655KI Strong Altered Expression [20]
Neoplasm DISZKGEW Strong Posttranslational Modification [21]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [22]
Obesity DIS47Y1K Strong Altered Expression [23]
Osteoarthritis DIS05URM Strong Biomarker [24]
Parkinson disease DISQVHKL Strong Biomarker [25]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [26]
Pneumonia DIS8EF3M Strong Biomarker [27]
Pneumonitis DIS88E0K Strong Biomarker [27]
Prostate cancer DISF190Y Strong Altered Expression [28]
Prostate carcinoma DISMJPLE Strong Altered Expression [28]
Rheumatoid arthritis DISTSB4J Strong Biomarker [29]
Cardiac failure DISDC067 moderate Biomarker [30]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [31]
leukaemia DISS7D1V moderate Biomarker [32]
Leukemia DISNAKFL moderate Biomarker [32]
Lung adenocarcinoma DISD51WR moderate Altered Expression [1]
Nervous system inflammation DISB3X5A moderate Altered Expression [33]
Neuralgia DISWO58J moderate Altered Expression [34]
Non-insulin dependent diabetes DISK1O5Z moderate Biomarker [35]
Pancreatic cancer DISJC981 moderate Biomarker [36]
Tuberculosis DIS2YIMD moderate Biomarker [37]
Osteosarcoma DISLQ7E2 Disputed Biomarker [38]
Bone osteosarcoma DIST1004 Limited Biomarker [38]
Neuroblastoma DISVZBI4 Limited Altered Expression [39]
Type-1/2 diabetes DISIUHAP Limited Altered Expression [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of E3 ubiquitin-protein ligase RNF19A (RNF19A). [41]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of E3 ubiquitin-protein ligase RNF19A (RNF19A). [44]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of E3 ubiquitin-protein ligase RNF19A (RNF19A). [49]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [42]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [43]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [45]
Testosterone DM7HUNW Approved Testosterone increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [46]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [47]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [48]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [50]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [51]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [52]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [53]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [54]
geraniol DMS3CBD Investigative geraniol increases the expression of E3 ubiquitin-protein ligase RNF19A (RNF19A). [55]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Synergistic Effect of Novel EGFR Inhibitor AZD8931 and p38 siRNA in Lung Adenocarcinoma Cancer Cells.Anticancer Agents Med Chem. 2019;19(5):638-644. doi: 10.2174/1871520619666190301125203.
2 IKK Promotes the Progression and Metastasis of Non-Small Cell Lung Cancer Independently of its Subcellular Localization.Comput Struct Biotechnol J. 2019 Feb 7;17:251-262. doi: 10.1016/j.csbj.2019.02.003. eCollection 2019.
3 Tanshinone IIA ameliorates cognitive deficits by inhibiting endoplasmic reticulum stress-induced apoptosis in APP/PS1 transgenic mice.Neurochem Int. 2020 Feb;133:104610. doi: 10.1016/j.neuint.2019.104610. Epub 2019 Nov 26.
4 Systemic administration of scAAV9-IGF1 extends survival in SOD1(G93A) ALS mice via inhibiting p38 MAPK and the JNK-mediated apoptosis pathway.Brain Res Bull. 2018 May;139:203-210. doi: 10.1016/j.brainresbull.2018.02.015. Epub 2018 Feb 27.
5 Neutrophil extracellular traps induced by IL-8 aggravate atherosclerosis via activation NF-B signaling in macrophages.Cell Cycle. 2019 Nov;18(21):2928-2938. doi: 10.1080/15384101.2019.1662678. Epub 2019 Sep 8.
6 Inhibition of spinal p38 MAPK prevents articular neutrophil infiltration in experimental arthritis via sympathetic activation.Fundam Clin Pharmacol. 2018 Apr;32(2):155-162. doi: 10.1111/fcp.12338. Epub 2017 Dec 22.
7 TNFAIP8 promotes cisplatin resistance in cervical carcinoma cells by inhibiting cellular apoptosis.Oncol Lett. 2019 May;17(5):4667-4674. doi: 10.3892/ol.2019.10076. Epub 2019 Feb 26.
8 Cancer-associated fibroblast (CAF)-derived IL32 promotes breast cancer cell invasion and metastasis via integrin 3-p38 MAPK signalling.Cancer Lett. 2019 Feb 1;442:320-332. doi: 10.1016/j.canlet.2018.10.015. Epub 2018 Oct 27.
9 Protective Effect of Hydroxysafflor Yellow A on Inflammatory Injury in Chronic Obstructive Pulmonary Disease Rats.Chin J Integr Med. 2019 Oct;25(10):750-756. doi: 10.1007/s11655-018-2577-2. Epub 2018 Dec 27.
10 In Vitro and in Vivo antitumor activity and the mechanism of siphonodictyal B in human colon cancer cells.Cancer Med. 2019 Sep;8(12):5662-5672. doi: 10.1002/cam4.2409. Epub 2019 Jul 31.
11 Effects of steroidal saponins extract from Ophiopogon japonicus root ameliorates doxorubicin-induced chronic heart failure by inhibiting oxidative stress and inflammatory response.Pharm Biol. 2019 Dec;57(1):176-183. doi: 10.1080/13880209.2019.1577467.
12 Chemerin/ChemR23 axis promotes inflammation of glomerular endothelial cells in diabetic nephropathy.J Cell Mol Med. 2019 May;23(5):3417-3428. doi: 10.1111/jcmm.14237. Epub 2019 Feb 19.
13 Lipoxin A(4) Suppresses IL-1-Induced Cyclooxygenase-2 Expression Through Inhibition of p38 MAPK Activation in Endometriosis.Reprod Sci. 2019 Dec;26(12):1640-1649. doi: 10.1177/1933719119828115. Epub 2019 Feb 17.
14 Correction to: inhibition of p38 MAPK activity leads to cell type-specific effects on the molecular circadian clock and time-dependent reduction of glioma cell invasiveness.BMC Cancer. 2019 Jan 23;19(1):101. doi: 10.1186/s12885-018-5238-0.
15 PRRX1 Regulates Cellular Phenotype Plasticity and Dormancy of Head and Neck Squamous Cell Carcinoma Through miR-642b-3p.Neoplasia. 2019 Feb;21(2):216-229. doi: 10.1016/j.neo.2018.12.001. Epub 2019 Jan 7.
16 Targeting monocyte-intrinsic enhancer reprogramming improves immunotherapy efficacy in hepatocellular carcinoma.Gut. 2020 Feb;69(2):365-379. doi: 10.1136/gutjnl-2018-317257. Epub 2019 May 10.
17 Regulation of MAP kinase-mediated endothelial dysfunction in hyperglycemia via arginase I and eNOS dysregulation.Biochim Biophys Acta Mol Cell Res. 2019 Sep;1866(9):1398-1411. doi: 10.1016/j.bbamcr.2019.05.004. Epub 2019 May 28.
18 SHARPIN Promotes Melanoma Progression viaRap1 Signaling Pathway.J Invest Dermatol. 2020 Feb;140(2):395-403.e6. doi: 10.1016/j.jid.2019.07.696. Epub 2019 Aug 8.
19 Iron overload may promote alteration of NK cells and hematopoietic stem/progenitor cells by JNK and P38 pathway in myelodysplastic syndromes.Int J Hematol. 2017 Aug;106(2):248-257. doi: 10.1007/s12185-017-2237-x. Epub 2017 Apr 12.
20 Effect of ulinastatin on myocardial ischemia-reperfusion injury through JNK and P38 MAPK signaling pathways.Eur Rev Med Pharmacol Sci. 2019 Oct;23(19):8658-8664. doi: 10.26355/eurrev_201910_19183.
21 Hyperoside exerts potent anticancer activity in skin cancer.Front Biosci (Landmark Ed). 2020 Jan 1;25(3):463-479. doi: 10.2741/4814.
22 LukS-PV induces cell cycle arrest and apoptosis through p38/ERK MAPK signaling pathway in NSCLC cells.Biochem Biophys Res Commun. 2020 Jan 22;521(4):846-852. doi: 10.1016/j.bbrc.2019.10.181. Epub 2019 Nov 7.
23 GDF5 Promotes White Adipose Tissue Thermogenesis via p38 MAPK Signaling Pathway.DNA Cell Biol. 2019 Nov;38(11):1303-1312. doi: 10.1089/dna.2019.4724. Epub 2019 Sep 25.
24 Tougu Xiaotong capsules may inhibit p38 MAPK pathway-mediated inflammation: In vivo and in vitro verification.J Ethnopharmacol. 2020 Mar 1;249:112390. doi: 10.1016/j.jep.2019.112390. Epub 2019 Nov 21.
25 MicroRNA-124 regulates the expression of p62/p38 and promotes autophagy in the inflammatory pathogenesis of Parkinson's disease.FASEB J. 2019 Jul;33(7):8648-8665. doi: 10.1096/fj.201900363R. Epub 2019 Apr 17.
26 Rafoxanide, an organohalogen drug, triggers apoptosis and cell cycle arrest in multiple myeloma by enhancing DNA damage responses and suppressing the p38 MAPK pathway.Cancer Lett. 2019 Mar 1;444:45-59. doi: 10.1016/j.canlet.2018.12.014. Epub 2018 Dec 21.
27 Epicatechin alleviates inflammation in lipopolysaccharide-induced acute lung injury in mice by inhibiting the p38 MAPK signaling pathway.Int Immunopharmacol. 2019 Jan;66:146-153. doi: 10.1016/j.intimp.2018.11.016. Epub 2018 Nov 16.
28 Knockdown of COPS3 inhibits the progress of prostate cancer through reducing phosphorylated p38 MAPK expression and impairs the epithelial-mesenchymal transition process.Prostate. 2019 Dec;79(16):1823-1831. doi: 10.1002/pros.23907. Epub 2019 Sep 11.
29 Protective Effects of Prunasin A against the Differentiation of Osteoclasts and Destruction of Cartilage via the Receptor Activator of Nuclear Factor-Kappa- Ligand/Mitogen-Activated Protein Kinase/Osteoprotegerin Pathway in a Rat Model of Arthritis.Pharmacology. 2019;104(5-6):216-225. doi: 10.1159/000502537. Epub 2019 Sep 12.
30 p38 MAPK proximity assay reveals a regulatory mechanism of alternative splicing in cardiomyocytes.Biochim Biophys Acta Mol Cell Res. 2019 Dec;1866(12):118557. doi: 10.1016/j.bbamcr.2019.118557. Epub 2019 Sep 7.
31 p38-regulated FOXC1 stability is required for colorectal cancer metastasis.J Pathol. 2020 Feb;250(2):217-230. doi: 10.1002/path.5362. Epub 2019 Nov 28.
32 Quinacrine induces apoptosis in human leukemia K562 cells via p38 MAPK-elicited BCL2 down-regulation and suppression of ERK/c-Jun-mediated BCL2L1 expression.Toxicol Appl Pharmacol. 2015 Apr 1;284(1):33-41. doi: 10.1016/j.taap.2015.02.005. Epub 2015 Feb 12.
33 Graphene quantum dots inhibit T cell-mediated neuroinflammation in rats.Neuropharmacology. 2019 Mar 1;146:95-108. doi: 10.1016/j.neuropharm.2018.11.030. Epub 2018 Nov 22.
34 Astrocyte activation in the periaqueductal gray promotes descending facilitation to cancer-induced bone pain through the JNK MAPK signaling pathway.Mol Pain. 2019 Jan-Dec;15:1744806919831909. doi: 10.1177/1744806919831909.
35 Large triglyceride-rich lipoproteins from fasting patients with type 2 diabetes activate platelets.Diabetes Metab. 2020 Feb;46(1):54-60. doi: 10.1016/j.diabet.2019.03.002. Epub 2019 Apr 11.
36 Aberrant expression of STYK1 and E-cadherin confer a poor prognosis for pancreatic cancer patients.Oncotarget. 2017 Nov 30;8(67):111333-111345. doi: 10.18632/oncotarget.22794. eCollection 2017 Dec 19.
37 A novel MtHSP70-FPR1 fusion protein enhances cytotoxic T lymphocyte responses to cervical cancer cells by activating human monocyte-derived dendritic cells via the p38 MAPK signaling pathway.Biochem Biophys Res Commun. 2018 Sep 10;503(3):2108-2116. doi: 10.1016/j.bbrc.2018.07.167. Epub 2018 Aug 8.
38 Artemisinin inhibits angiogenesis by regulating p38 MAPK/CREB/TSP-1 signaling pathway in osteosarcoma.J Cell Biochem. 2019 Jul;120(7):11462-11470. doi: 10.1002/jcb.28424. Epub 2019 Feb 11.
39 Macrophage-Derived IL1 and TNF Regulate Arginine Metabolism in Neuroblastoma.Cancer Res. 2019 Feb 1;79(3):611-624. doi: 10.1158/0008-5472.CAN-18-2139. Epub 2018 Dec 13.
40 Deep sea minerals ameliorate diabetic-induced inflammation via inhibition of TNF signaling pathways.Environ Toxicol. 2020 Apr;35(4):468-477. doi: 10.1002/tox.22882. Epub 2019 Dec 3.
41 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
42 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
43 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
44 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
45 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
46 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
47 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
48 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
49 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
50 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
51 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
52 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
53 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
54 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
55 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.