Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKXQMNA)

• DOT Name: Abnormal spindle-like microcephaly-associated protein (ASPM)
• Synonyms: Abnormal spindle protein homolog; Asp homolog
• Gene Name: ASPM
• Related Disease:
  Glioma
  Hepatitis C virus infection
  Microcephaly 5, primary, autosomal recessive
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Arthrogryposis
  Autosomal recessive primary microcephaly
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Depression
  Fibrodysplasia ossificans progressiva
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Isolated congenital microcephaly
  leukaemia
  Leukemia
  Liver cirrhosis
  Major depressive disorder
  Matthew-Wood syndrome
  Medulloblastoma
  Microcephaly
  Myocardial infarction
  Neoplasm
  Non-small-cell lung cancer
  Obesity
  Osteoarthritis
  Pancreatic cancer
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Schizophrenia
  Triple negative breast cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Lung adenocarcinoma
  Metastatic malignant neoplasm
  Adult glioblastoma
  Rheumatoid arthritis
  Clear cell renal carcinoma
  Epithelial ovarian cancer
  Intellectual disability
  Ovarian cancer
  Ovarian neoplasm
• UniProt ID: ASPM_HUMAN
• Pfam ID: PF15780 ; PF00307 ; PF00612
• Sequence:
  MANRRVGRGCWEVSPTERRPPAGLRGPAAEEEASSPPVLSLSHFCRSPFLCFGDVLLGAS
  RTLSLALDNPNEEVAEVKISHFPAADLGFSVSQRCFVLQPKEKIVISVNWTPLKEGRVRE
  IMTFLVNDVLKHQAILLGNAEEQKKKKRSLWDTIKKKKISASTSHNRRVSNIQNVNKTFS
  VSQKVDRVRSPLQACENLAMNEGGPPTENNSLILEENKIPISPISPAFNECHGATCLPLS
  VRRSTTYSSLHASENRELLNVHSANVSKVSFNEKAVTETSFNSVNVNGQRGENSKLSLTP
  NCSSTLNITQSQIHFLSPDSFVNNSHGANNELELVTCLSSDMFMKDNSQPVHLESTIAHE
  IYQKILSPDSFIKDNYGLNQDLESESVNPILSPNQFLKDNMAYMCTSQQTCKVPLSNENS
  QVPQSPEDWRKSEVSPRIPECQGSKSPKAIFEELVEMKSNYYSFIKQNNPKFSAVQDISS
  HSHNKQPKRRPILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKED
  FHSYLPIIDPILSKSKSYKNEVTPSSTTASVARKRKSDGSMEDANVRVAITEHTEVREIK
  RIHFSPSEPKTSAVKKTKNVTTPISKRISNREKLNLKKKTDLSIFRTPISKTNKRTKPII
  AVAQSSLTFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVKT
  NISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVK
  AIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLED
  NSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYA
  KISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDE
  FDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRG
  IELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIK
  KTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSD
  GRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHE
  NTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARL
  LDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAAL
  VIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSR
  IRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQRKMQ
  SQVKATVILQRAFREWHLRKQAKEENSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRC
  FQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQI
  RAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYI
  FAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKN
  ATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVR
  GYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQ
  VKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRA
  YKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLF
  KTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSY
  YRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRI
  KDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKI
  QSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQR
  EKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQ
  QRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRR
  RFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATF
  IQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKT
  RRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLYQFLHLRKA
  AITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAA
  KLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWAT
  KIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKI
  RKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYR
  MHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVRQKLKN
  VSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVT
  IQKAFCRMVTRKLETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFL
  LYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQ
  AMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNV
  RASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQ
  KYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLN
  AVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQ
  RNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKAIRLSLQVVN
  REIREENKLYKRTALALHYLLTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIF
  VLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNK
  VADKGGSIFTKTCCLLAILLKTTNRASDVRSRSKVVDRIYSLYKLTAHKHKMNTERILYK
  QKKNSSISIPFIPETPVRTRIVSRLKPDWVLRRDNMEEITNPLQAIQMVMDTLGIPY
• Function: Involved in mitotic spindle regulation and coordination of mitotic processes. The function in regulating microtubule dynamics at spindle poles including spindle orientation, astral microtubule density and poleward microtubule flux seems to depend on the association with the katanin complex formed by KATNA1 and KATNB1. Enhances the microtubule lattice severing activity of KATNA1 by recruiting the katanin complex to microtubules. Can block microtubule minus-end growth and reversely this function can be enhanced by the katanin complex. May have a preferential role in regulating neurogenesis.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Altered Expression	[1]
Hepatitis C virus infection	DISQ0M8R	Definitive	Biomarker	[2]
Microcephaly 5, primary, autosomal recessive	DISM0PCT	Definitive	Autosomal recessive	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[6]
Arthrogryposis	DISC81CM	Strong	Genetic Variation	[7]
Autosomal recessive primary microcephaly	DIS29IE3	Strong	Autosomal recessive	[8]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[9]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[10]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[11]
Depression	DIS3XJ69	Strong	Biomarker	[12]
Fibrodysplasia ossificans progressiva	DISAT6WU	Strong	Biomarker	[13]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Isolated congenital microcephaly	DISUXHZ6	Strong	Genetic Variation	[16]
leukaemia	DISS7D1V	Strong	Biomarker	[17]
Leukemia	DISNAKFL	Strong	Biomarker	[17]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[2]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[12]
Matthew-Wood syndrome	DISA7HR7	Strong	Altered Expression	[18]
Medulloblastoma	DISZD2ZL	Strong	Altered Expression	[19]
Microcephaly	DIS2GRD8	Strong	Genetic Variation	[20]
Myocardial infarction	DIS655KI	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Altered Expression	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[23]
Obesity	DIS47Y1K	Strong	Altered Expression	[24]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[25]
Pancreatic cancer	DISJC981	Strong	Biomarker	[18]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[26]
Prostate cancer	DISF190Y	Strong	Biomarker	[27]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[27]
Schizophrenia	DISSRV2N	Strong	Biomarker	[28]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[29]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[9]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[9]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[22]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[4]
Adult glioblastoma	DISVP4LU	Disputed	Biomarker	[14]
Rheumatoid arthritis	DISTSB4J	Disputed	Biomarker	[30]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[31]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[32]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[33]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[32]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[32]

38 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[41]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[43]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[45]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[44]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[46]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[47]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[48]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[49]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[50]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[51]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[52]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[53]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[54]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[55]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[56]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[57]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[58]
Riboflavin	DM8YMWE	Approved	Riboflavin affects the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[59]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[41]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[60]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[61]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[62]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[64]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[66]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[67]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[68]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[49]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[69]
Hydroxybenzo(a)pyrene	DM9H5EN	Investigative	Hydroxybenzo(a)pyrene decreases the expression of Abnormal spindle-like microcephaly-associated protein (ASPM).	[70]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Abnormal spindle-like microcephaly-associated protein (ASPM).	[63]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Abnormal spindle-like microcephaly-associated protein (ASPM).	[65]

References

• [1] Expression analysis of the autosomal recessive primary microcephaly genes MCPH1 (microcephalin) and MCPH5 (ASPM, abnormal spindle-like, microcephaly associated) in human malignant gliomas.Oncol Rep. 2008 Aug;20(2):301-8.
• [2] Strong correlation between ASPM gene expression and HCV cirrhosis progression identified by co-expression analysis.Dig Liver Dis. 2017 Jan;49(1):70-76. doi: 10.1016/j.dld.2016.10.017. Epub 2016 Nov 4.
• [3] ASPM is a major determinant of cerebral cortical size. Nat Genet. 2002 Oct;32(2):316-20. doi: 10.1038/ng995. Epub 2002 Sep 23.
• [4] High expression of ASPM correlates with tumor progression and predicts poor outcome in patients with prostate cancer.Int Urol Nephrol. 2017 May;49(5):817-823. doi: 10.1007/s11255-017-1545-7. Epub 2017 Feb 17.
• [5] Metabolite Profile of Alzheimer's Disease in the Frontal Cortex as Analyzed by HRMAS (1)H NMR.Front Aging Neurosci. 2019 Jan 9;10:424. doi: 10.3389/fnagi.2018.00424. eCollection 2018.
• [6] In vitro activation of GAT1 transporters expressed in spinal cord gliosomes stimulates glutamate release that is abnormally elevated in the SOD1/G93A(+) mouse model of amyotrophic lateral sclerosis.J Neurochem. 2010 Apr;113(2):489-501. doi: 10.1111/j.1471-4159.2010.06628.x. Epub 2010 Feb 1.
• [7] The genomic and clinical landscape of fetal akinesia.Genet Med. 2020 Mar;22(3):511-523. doi: 10.1038/s41436-019-0680-1. Epub 2019 Nov 4.
• [8] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [9] Overexpression of the ASPM gene is associated with aggressiveness and poor outcome in bladder cancer.Oncol Lett. 2019 Feb;17(2):1865-1876. doi: 10.3892/ol.2018.9762. Epub 2018 Nov 26.
• [10] ErbB4 receptor polymorphism 2368A>C and risk of breast cancer.Breast. 2018 Dec;42:157-163. doi: 10.1016/j.breast.2018.10.002. Epub 2018 Oct 9.
• [11] KRAS mutations in non-small-cell lung cancer and colorectal cancer: implications for EGFR-targeted therapies.Lung Cancer. 2014 Feb;83(2):163-7. doi: 10.1016/j.lungcan.2013.11.010. Epub 2013 Nov 21.
• [12] Aversive startle potentiation and fear pathology: Mediating role of threat sensitivity and moderating impact of depression.Int J Psychophysiol. 2015 Nov;98(2 Pt 2):262-269. doi: 10.1016/j.ijpsycho.2014.10.014. Epub 2014 Nov 6.
• [13] Restoration of normal BMP signaling levels and osteogenic differentiation in FOP mesenchymal progenitor cells by mutant allele-specific targeting.Gene Ther. 2012 Jul;19(7):786-90. doi: 10.1038/gt.2011.152. Epub 2011 Oct 20.
• [14] ASPM gene expression in medulloblastoma.Childs Nerv Syst. 2011 Jan;27(1):71-4. doi: 10.1007/s00381-010-1252-5. Epub 2010 Aug 6.
• [15] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [16] Longitudinal Diffusion Tensor Imaging Revealed Nerve Fiber Alterations in Aspm Mutated Microcephaly Model Mice.Neuroscience. 2018 Feb 10;371:325-336. doi: 10.1016/j.neuroscience.2017.12.012. Epub 2017 Dec 16.
• [17] Growth inhibitory and proapoptotic effects of l-asparaginase from Fusarium culmorum ASP-87 on human leukemia cells (Jurkat).Fundam Clin Pharmacol. 2017 Jun;31(3):292-300. doi: 10.1111/fcp.12257. Epub 2016 Dec 30.
• [18] Elucidating the roles of ASPM isoforms reveals a novel prognostic marker for pancreatic cancer.J Pathol. 2020 Feb;250(2):123-125. doi: 10.1002/path.5355. Epub 2019 Dec 2.
• [19] Expression profile of frizzled receptors in human medulloblastomas.J Neurooncol. 2012 Jan;106(2):271-80. doi: 10.1007/s11060-011-0682-6. Epub 2011 Aug 18.
• [20] Expanding the clinical and neuroradiologic phenotype of primary microcephaly due to ASPM mutations.Neurology. 2009 Sep 22;73(12):962-9. doi: 10.1212/WNL.0b013e3181b8799a.
• [21] Asprosin improves the survival of mesenchymal stromal cells in myocardial infarction by inhibiting apoptosis via the activated ERK1/2-SOD2 pathway.Life Sci. 2019 Aug 15;231:116554. doi: 10.1016/j.lfs.2019.116554. Epub 2019 Jun 10.
• [22] Enhancement of tumor initiation and expression of KCNMA1, MORF4L2 and ASPM genes in the adenocarcinoma of lung xenograft after vorinostat treatment.Oncotarget. 2015 Apr 20;6(11):8663-75. doi: 10.18632/oncotarget.3536.
• [23] Sensitive methods for screening of the MEK1 gene mutations in patients with central nervous system metastases of non-small cell lung cancer.Clin Transl Oncol. 2016 Oct;18(10):1039-43. doi: 10.1007/s12094-016-1483-3. Epub 2016 Feb 9.
• [24] The mouse mahoganoid coat color mutation disrupts a novel C3HC4 RING domain protein.J Clin Invest. 2002 Nov;110(10):1449-59. doi: 10.1172/JCI16131.
• [25] Angelica Sinensis polysaccharides stimulated UDP-sugar synthase genes through promoting gene expression of IGF-1 and IGF1R in chondrocytes: promoting anti-osteoarthritic activity.PLoS One. 2014 Sep 9;9(9):e107024. doi: 10.1371/journal.pone.0107024. eCollection 2014.
• [26] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [27] Correction: ASPM promotes prostate cancer stemness and progression by augmenting Wnt-Dvl-3--catenin signaling.Oncogene. 2019 Feb;38(8):1354. doi: 10.1038/s41388-018-0561-0.
• [28] C3 Polymorphism Influences Circulating Levels of C3, ASP and Lipids in Schizophrenic Patients.Neurochem Res. 2015 May;40(5):906-14. doi: 10.1007/s11064-015-1543-z. Epub 2015 Feb 27.
• [29] Molecular features of triple negative breast cancer cells by genome-wide gene expression profiling analysis.Int J Oncol. 2013 Feb;42(2):478-506. doi: 10.3892/ijo.2012.1744. Epub 2012 Dec 18.
• [30] High rates of tuberculin skin test positivity due to methotrexate therapy: False positive results?.Semin Arthritis Rheum. 2018 Dec;48(3):538-546. doi: 10.1016/j.semarthrit.2018.03.018. Epub 2018 Mar 29.
• [31] Identification of key genes involved in the metastasis of clear cell renal cell carcinoma.Oncol Lett. 2019 May;17(5):4321-4328. doi: 10.3892/ol.2019.10130. Epub 2019 Mar 8.
• [32] ASPM and microcephalin expression in epithelial ovarian cancer correlates with tumour grade and survival.Br J Cancer. 2011 May 10;104(10):1602-10. doi: 10.1038/bjc.2011.117. Epub 2011 Apr 19.
• [33] Evolution of ASPM coding variation in apes and associations with brain structure in chimpanzees.Genes Brain Behav. 2019 Sep;18(7):e12582. doi: 10.1111/gbb.12582. Epub 2019 Jun 11.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [41] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [44] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [45] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [46] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [47] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [48] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [49] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [50] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [51] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [52] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [53] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [54] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [55] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [56] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [57] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [58] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [59] Riboflavin depletion impairs cell proliferation in adult human duodenum: identification of potential effectors. Dig Dis Sci. 2011 Apr;56(4):1007-19. doi: 10.1007/s10620-010-1374-3. Epub 2010 Sep 17.
• [60] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [61] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [62] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [63] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [64] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [65] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [66] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [67] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [68] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [69] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [70] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.