Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPKSK43)

• DOT Name: Tumor protein D52 (TPD52)
• Synonyms: Protein N8
• Gene Name: TPD52
• Related Disease:
  Myocardial infarction
  Acute myelogenous leukaemia
  Advanced cancer
  Breast neoplasm
  Carcinoma
  Cholangiocarcinoma
  Chronic renal failure
  Clear cell renal carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Colorectal neoplasm
  Congenital contractural arachnodactyly
  Diabetic kidney disease
  End-stage renal disease
  Glioma
  Hemangioma
  Hepatocellular carcinoma
  High blood pressure
  Hyperinsulinemia
  Insulinoma
  Lung squamous cell carcinoma
  Melanoma
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Seminoma
  Type-1/2 diabetes
  Adenoma
  Epithelial ovarian cancer
  Hereditary breast carcinoma
  Metastatic malignant neoplasm
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Gallbladder cancer
  Gallbladder carcinoma
  leukaemia
  Nasopharyngeal carcinoma
  Neuroblastoma
  Pancreatic cancer
  Prostate neoplasm
  Rheumatoid arthritis
  T-cell acute lymphoblastic leukaemia
• UniProt ID: TPD52_HUMAN
• Pfam ID: PF04201
• Sequence:
  MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGED
  VAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELK
  QNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEK
  VENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
• Tissue Specificity: Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.
• Reactome Pathway: Golgi Associated Vesicle Biogenesis (R-HSA-432722)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Myocardial infarction	DIS655KI	Definitive	Genetic Variation	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Carcinoma	DISH9F1N	Strong	Altered Expression	[5]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[6]
Chronic renal failure	DISGG7K6	Strong	Genetic Variation	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[10]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[9]
Congenital contractural arachnodactyly	DISOM1K7	Strong	Altered Expression	[6]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[11]
End-stage renal disease	DISXA7GG	Strong	Genetic Variation	[7]
Glioma	DIS5RPEH	Strong	Biomarker	[12]
Hemangioma	DISDCGAG	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[15]
Hyperinsulinemia	DISIDWT6	Strong	Altered Expression	[16]
Insulinoma	DISIU1JS	Strong	Altered Expression	[16]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[17]
Melanoma	DIS1RRCY	Strong	Biomarker	[18]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[3]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[8]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[20]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[21]
Adenoma	DIS78ZEV	moderate	Altered Expression	[22]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[22]
Hereditary breast carcinoma	DISAEZT5	moderate	Altered Expression	[23]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[24]
Neoplasm	DISZKGEW	moderate	Biomarker	[25]
Ovarian cancer	DISZJHAP	moderate	Biomarker	[22]
Ovarian neoplasm	DISEAFTY	moderate	Biomarker	[22]
Gallbladder cancer	DISXJUAF	Limited	Biomarker	[26]
Gallbladder carcinoma	DISD6ACL	Limited	Biomarker	[26]
leukaemia	DISS7D1V	Limited	Altered Expression	[5]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[27]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[28]
Pancreatic cancer	DISJC981	Limited	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Limited	Therapeutic	[29]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[30]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Limited	Altered Expression	[5]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Tumor protein D52 (TPD52) affects the response to substance of Mitomycin.	[49]
Mitoxantrone	DMM39BF	Approved	Tumor protein D52 (TPD52) affects the response to substance of Mitoxantrone.	[49]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Tumor protein D52 (TPD52).	[31]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Tumor protein D52 (TPD52).	[46]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Tumor protein D52 (TPD52).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tumor protein D52 (TPD52).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Tumor protein D52 (TPD52).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Tumor protein D52 (TPD52).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Tumor protein D52 (TPD52).	[36]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tumor protein D52 (TPD52).	[37]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Tumor protein D52 (TPD52).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Tumor protein D52 (TPD52).	[39]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Tumor protein D52 (TPD52).	[40]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Tumor protein D52 (TPD52).	[41]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Tumor protein D52 (TPD52).	[42]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Tumor protein D52 (TPD52).	[41]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Tumor protein D52 (TPD52).	[41]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Tumor protein D52 (TPD52).	[43]
Nifedipine	DMSVOZT	Approved	Nifedipine increases the expression of Tumor protein D52 (TPD52).	[41]
Clonidine	DM6RZ9Q	Approved	Clonidine increases the expression of Tumor protein D52 (TPD52).	[41]
Tolbutamide	DM02AWV	Approved	Tolbutamide decreases the expression of Tumor protein D52 (TPD52).	[41]
Mannitol	DMSCDY9	Approved	Mannitol decreases the expression of Tumor protein D52 (TPD52).	[41]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Tumor protein D52 (TPD52).	[43]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Tumor protein D52 (TPD52).	[44]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Tumor protein D52 (TPD52).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Tumor protein D52 (TPD52).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Tumor protein D52 (TPD52).	[45]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID decreases the expression of Tumor protein D52 (TPD52).	[41]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Tumor protein D52 (TPD52).	[47]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Tumor protein D52 (TPD52).	[48]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 decreases the expression of Tumor protein D52 (TPD52).	[41]

References

• [1] The K121Q polymorphism of the ENPP1/PC-1 gene is associated with insulin resistance/atherogenic phenotypes, including earlier onset of type 2 diabetes and myocardial infarction.Diabetes. 2005 Oct;54(10):3021-5. doi: 10.2337/diabetes.54.10.3021.
• [2] Prognostic role of TPD52 in acute myeloid leukemia: A retrospective multicohort analysis.J Cell Biochem. 2019 Mar;120(3):3672-3678. doi: 10.1002/jcb.27645. Epub 2018 Sep 11.
• [3] Tumor protein D52 (isoform 3) interacts with and promotes peroxidase activity of Peroxiredoxin 1 in prostate cancer cells implicated in cell growth and migration.Biochim Biophys Acta Mol Cell Res. 2019 Aug;1866(8):1298-1309. doi: 10.1016/j.bbamcr.2019.04.007. Epub 2019 Apr 11.
• [4] Nonredundant functions for tumor protein D52-like proteins support specific targeting of TPD52.Clin Cancer Res. 2008 Aug 15;14(16):5050-60. doi: 10.1158/1078-0432.CCR-07-4994.
• [5] Expression of tumor protein D52-like genes in childhood leukemia at diagnosis: clinical and sample considerations.Leuk Res. 2006 Nov;30(11):1355-63. doi: 10.1016/j.leukres.2006.03.009. Epub 2006 Apr 18.
• [6] Identification of TPD52 and DNAJB1 as two novel bile biomarkers for cholangiocarcinoma by iTRAQbased quantitative proteomics analysis.Oncol Rep. 2019 Dec;42(6):2622-2634. doi: 10.3892/or.2019.7387. Epub 2019 Oct 23.
• [7] Increase in and clearance of cell-free plasma DNA in hemodialysis quantified by real-time PCR.Clin Chem Lab Med. 2006;44(12):1410-5. doi: 10.1515/CCLM.2006.252.
• [8] Tumor Protein D52 (TPD52) Inhibits Growth and Metastasis in Renal Cell Carcinoma Cells Through the PI3K/Akt Signaling Pathway.Oncol Res. 2017 May 24;25(5):773-779. doi: 10.3727/096504016X14774889687280. Epub 2016 Nov 8.
• [9] Expression of chloride intracellular channel protein 1 (CLIC1) and tumor protein D52 (TPD52) as potential biomarkers for colorectal cancer.Clin Biochem. 2008 Oct;41(14-15):1224-36. doi: 10.1016/j.clinbiochem.2008.07.012. Epub 2008 Jul 30.
• [10] The four-transmembrane protein MAL2 and tumor protein D52 (TPD52) are highly expressed in colorectal cancer and correlated with poor prognosis.PLoS One. 2017 May 31;12(5):e0178515. doi: 10.1371/journal.pone.0178515. eCollection 2017.
• [11] The role of PC-1 and ACE genes in diabetic nephropathy in type 1 diabetic patients: evidence for a polygenic control of kidney disease progression.Nephrol Dial Transplant. 2002 Aug;17(8):1402-7. doi: 10.1093/ndt/17.8.1402.
• [12] Lentivirus-mediated knockdown of tumor protein D52-like 2 inhibits glioma cell proliferation.Cell Mol Biol (Noisy-le-grand). 2014 May 11;60(1):39-44.
• [13] Long non-coding RNA 00152 slicing represses the growth and aggressiveness of hemangioma cell by modulating miR-139-5p.Biomed Pharmacother. 2019 Dec;120:109385. doi: 10.1016/j.biopha.2019.109385. Epub 2019 Sep 19.
• [14] Decreased TPD52 expression is associated with poor prognosis in primary hepatocellular carcinoma.Oncotarget. 2016 Feb 2;7(5):6323-34. doi: 10.18632/oncotarget.6319.
• [15] The association of the K121Q polymorphism of the plasma cell glycoprotein-1 gene with type 2 diabetes and hypertension depends on size at birth.J Clin Endocrinol Metab. 2004 May;89(5):2044-7. doi: 10.1210/jc.2003-031350.
• [16] High insulin levels do not influence PC-1 gene expression and protein content in human muscle tissue and hepatoma cells.Diabetes Metab Res Rev. 2000 Jan-Feb;16(1):26-32. doi: 10.1002/(sici)1520-7560(200001/02)16:1<26::aid-dmrr78>3.0.co;2-n.
• [17] Regulation of TPD52 by antitumor microRNA-218 suppresses cancer cell migration and invasion in lung squamous cell carcinoma.Int J Oncol. 2016 Nov;49(5):1870-1880. doi: 10.3892/ijo.2016.3690. Epub 2016 Sep 13.
• [18] Cloning, chromosomal localization, and tissue expression of autotaxin from human teratocarcinoma cells.Biochem Biophys Res Commun. 1996 Jan 26;218(3):714-9. doi: 10.1006/bbrc.1996.0127.
• [19] Association of genetic polymorphism of PC-1 gene (rs1044498 Lys121Gln) with insulin-resistant type 2 diabetes mellitus in Punjabi Population of Pakistan.Mol Genet Genomic Med. 2019 Aug;7(8):e775. doi: 10.1002/mgg3.775. Epub 2019 Jun 28.
• [20] TPD52, a candidate gene from genomic studies, is overexpressed in testicular germ cell tumours.Mol Cell Endocrinol. 2009 Jul 10;306(1-2):75-80. doi: 10.1016/j.mce.2008.10.043. Epub 2008 Nov 11.
• [21] Expressional and functional studies of Wolframin, the gene function deficient in Wolfram syndrome, in mice and patient cells.Exp Gerontol. 2005 Aug-Sep;40(8-9):671-8. doi: 10.1016/j.exger.2005.06.008.
• [22] Tumor protein D52 (TPD52) is overexpressed and a gene amplification target in ovarian cancer.Int J Cancer. 2005 Dec 20;117(6):1049-54. doi: 10.1002/ijc.21250.
• [23] TPD52 and NFKB1 gene expression levels correlate with G2 chromosomal radiosensitivity in lymphocytes of women with and at risk of hereditary breast cancer.Int J Radiat Biol. 2007 Jun;83(6):409-20. doi: 10.1080/09553000701317366.
• [24] Tumor protein D52 (isoform 3) contributes to prostate cancer cell growth via targeting nuclear factor-B transactivation in LNCaP cells.Tumour Biol. 2017 May;39(5):1010428317698382. doi: 10.1177/1010428317698382.
• [25] Silencing of TPD52 inhibits proliferation, migration, invasion but induces apoptosis of pancreatic cancer cells by deactivating Akt pathway.Neoplasma. 2020 Mar;67(2):277-285. doi: 10.4149/neo_2019_190404N295. Epub 2019 Dec 17.
• [26] Global methylation profiling to identify epigenetic signature of gallbladder cancer and gallstone disease.Tumour Biol. 2016 Nov;37(11):14687-14699. doi: 10.1007/s13277-016-5355-9. Epub 2016 Sep 14.
• [27] MicroRNA-449b-5p suppresses cell proliferation, migration and invasion by targeting TPD52 in nasopharyngeal carcinoma.J Biochem. 2019 Nov 1;166(5):433-440. doi: 10.1093/jb/mvz057.
• [28] All-Trans-Retinoic Acid Stimulates Overexpression of Tumor Protein D52 (TPD52, Isoform 3) and Neuronal Differentiation of IMR-32 Cells.J Cell Biochem. 2017 Dec;118(12):4358-4369. doi: 10.1002/jcb.26090. Epub 2017 May 8.
• [29] DNA methylome changes by estradiol benzoate and bisphenol A links early-life environmental exposures to prostate cancer risk.Epigenetics. 2016 Sep;11(9):674-689. doi: 10.1080/15592294.2016.1208891. Epub 2016 Jul 14.
• [30] Genetic influences on susceptibility to rheumatoid arthritis in African-Americans.Hum Mol Genet. 2019 Mar 1;28(5):858-874. doi: 10.1093/hmg/ddy395.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [33] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [37] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [38] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [39] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [40] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [41] Human embryonic stem cell derived hepatocyte-like cells as a tool for in vitro hazard assessment of chemical carcinogenicity. Toxicol Sci. 2011 Dec;124(2):278-90. doi: 10.1093/toxsci/kfr225. Epub 2011 Aug 27.
• [42] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [43] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [44] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [47] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [48] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [49] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.