Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPV5LUK)

• DOT Name: Myc proto-oncogene protein (MYC)
• Synonyms: Class E basic helix-loop-helix protein 39; bHLHe39; Proto-oncogene c-Myc; Transcription factor p64
• Gene Name: MYC
• Related Disease: Burkitt lymphoma
• UniProt ID: MYC_HUMAN
• PDB ID: 1A93; 1EE4; 1MV0; 1NKP; 2A93; 2OR9; 4Y7R; 5I4Z; 5I50; 6C4U; 6E16; 6E24; 6G6J; 6G6K; 6G6L; 7T1Y; 7T1Z; 8OTS; 8OTT
• Pfam ID: PF00010 ; PF02344 ; PF01056
• Sequence:
  MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
  SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
  LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
  RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
  STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
  GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
  RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
  VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
• Function: Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release. Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  ErbB sig.ling pathway (hsa04012)
  Cell cycle (hsa04110)
  PI3K-Akt sig.ling pathway (hsa04151)
  Cellular senescence (hsa04218)
  Wnt sig.ling pathway (hsa04310)
  TGF-beta sig.ling pathway (hsa04350)
  Hippo sig.ling pathway (hsa04390)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
  JAK-STAT sig.ling pathway (hsa04630)
  Thyroid hormone sig.ling pathway (hsa04919)
  Salmonella infection (hsa05132)
  Hepatitis C (hsa05160)
  Hepatitis B (hsa05161)
  Human cytomegalovirus infection (hsa05163)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  Transcriptio.l misregulation in cancer (hsa05202)
  Proteoglycans in cancer (hsa05205)
  MicroR.s in cancer (hsa05206)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Colorectal cancer (hsa05210)
  Endometrial cancer (hsa05213)
  Thyroid cancer (hsa05216)
  Bladder cancer (hsa05219)
  Chronic myeloid leukemia (hsa05220)
  Acute myeloid leukemia (hsa05221)
  Small cell lung cancer (hsa05222)
  Breast cancer (hsa05224)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)
  Central carbon metabolism in cancer (hsa05230)
• Reactome Pathway:
  Signaling by ALK (R-HSA-201556)
  NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947)
  SMAD2/SMAD3 (R-HSA-2173796)
  Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606)
  Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)
  Binding of TCF/LEF (R-HSA-4411364)
  MAPK6/MAPK4 signaling (R-HSA-5687128)
  Ub-specific processing proteases (R-HSA-5689880)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Cyclin E associated events during G1/S transition (R-HSA-69202)
  Cyclin A (R-HSA-69656)
  TFAP2 (AP-2) family regulates transcription of cell cycle factors (R-HSA-8866911)
  RUNX3 regulates WNT signaling (R-HSA-8951430)
  Estrogen-dependent gene expression (R-HSA-9018519)
  Transcriptional regulation of granulopoiesis (R-HSA-9616222)
  Regulation of NFE2L2 gene expression (R-HSA-9818749)
  Transcription of E2F targets under negative control by DREAM complex (R-HSA-1362277)
• BioCyc Pathway: MetaCyc:ENSG00000136997-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Burkitt lymphoma	DIS9D5XU	No Known	Unknown	[1]

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Gemcitabine	DMSE3I7	Approved	Myc proto-oncogene protein (MYC) affects the response to substance of Gemcitabine.	[99]
Vinblastine	DM5TVS3	Approved	Myc proto-oncogene protein (MYC) affects the response to substance of Vinblastine.	[100]
Staurosporine	DM0E9BR	Investigative	Myc proto-oncogene protein (MYC) decreases the response to substance of Staurosporine.	[102]
DZNep	DM0JXBK	Investigative	Myc proto-oncogene protein (MYC) increases the response to substance of DZNep.	[103]
CHALCONE	DM16QTM	Investigative	Myc proto-oncogene protein (MYC) affects the response to substance of CHALCONE.	[104]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Glutathione	DMAHMT9	Approved	Myc proto-oncogene protein (MYC) affects the abundance of Glutathione.	[101]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Myc proto-oncogene protein (MYC).	[2]
Fluoxetine	DM3PD2C	Approved	Fluoxetine decreases the phosphorylation of Myc proto-oncogene protein (MYC).	[54]
Selegiline	DM6034S	Approved	Selegiline increases the phosphorylation of Myc proto-oncogene protein (MYC).	[80]

97 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Myc proto-oncogene protein (MYC).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Myc proto-oncogene protein (MYC).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Myc proto-oncogene protein (MYC).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Myc proto-oncogene protein (MYC).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Myc proto-oncogene protein (MYC).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Myc proto-oncogene protein (MYC).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Myc proto-oncogene protein (MYC).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Myc proto-oncogene protein (MYC).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Myc proto-oncogene protein (MYC).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Myc proto-oncogene protein (MYC).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Myc proto-oncogene protein (MYC).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Myc proto-oncogene protein (MYC).	[14]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Myc proto-oncogene protein (MYC).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Myc proto-oncogene protein (MYC).	[16]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Myc proto-oncogene protein (MYC).	[17]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Myc proto-oncogene protein (MYC).	[18]
Marinol	DM70IK5	Approved	Marinol increases the expression of Myc proto-oncogene protein (MYC).	[19]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Myc proto-oncogene protein (MYC).	[20]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Myc proto-oncogene protein (MYC).	[21]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Myc proto-oncogene protein (MYC).	[22]
Menadione	DMSJDTY	Approved	Menadione decreases the expression of Myc proto-oncogene protein (MYC).	[23]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Myc proto-oncogene protein (MYC).	[24]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Myc proto-oncogene protein (MYC).	[25]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Myc proto-oncogene protein (MYC).	[26]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Myc proto-oncogene protein (MYC).	[27]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Myc proto-oncogene protein (MYC).	[28]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Myc proto-oncogene protein (MYC).	[29]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Myc proto-oncogene protein (MYC).	[30]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Myc proto-oncogene protein (MYC).	[31]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Myc proto-oncogene protein (MYC).	[32]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Myc proto-oncogene protein (MYC).	[33]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Myc proto-oncogene protein (MYC).	[34]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Myc proto-oncogene protein (MYC).	[35]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Myc proto-oncogene protein (MYC).	[36]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Myc proto-oncogene protein (MYC).	[37]
Nicotine	DMWX5CO	Approved	Nicotine increases the activity of Myc proto-oncogene protein (MYC).	[38]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Myc proto-oncogene protein (MYC).	[39]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Myc proto-oncogene protein (MYC).	[40]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Myc proto-oncogene protein (MYC).	[41]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Myc proto-oncogene protein (MYC).	[42]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Myc proto-oncogene protein (MYC).	[43]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone decreases the expression of Myc proto-oncogene protein (MYC).	[44]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Myc proto-oncogene protein (MYC).	[45]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Myc proto-oncogene protein (MYC).	[46]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Myc proto-oncogene protein (MYC).	[47]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Myc proto-oncogene protein (MYC).	[48]
Acocantherin	DM7JT24	Approved	Acocantherin decreases the expression of Myc proto-oncogene protein (MYC).	[49]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Myc proto-oncogene protein (MYC).	[50]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Myc proto-oncogene protein (MYC).	[51]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Myc proto-oncogene protein (MYC).	[52]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the expression of Myc proto-oncogene protein (MYC).	[53]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Myc proto-oncogene protein (MYC).	[55]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Myc proto-oncogene protein (MYC).	[56]
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin decreases the expression of Myc proto-oncogene protein (MYC).	[57]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the expression of Myc proto-oncogene protein (MYC).	[58]
Dactinomycin	DM2YGNW	Approved	Dactinomycin decreases the expression of Myc proto-oncogene protein (MYC).	[59]
Ardeparin	DMYRX8B	Approved	Ardeparin increases the expression of Myc proto-oncogene protein (MYC).	[60]
Vitamin A	DMJ2AH4	Approved	Vitamin A decreases the expression of Myc proto-oncogene protein (MYC).	[61]
Sevoflurane	DMC9O43	Approved	Sevoflurane increases the expression of Myc proto-oncogene protein (MYC).	[62]
Adenosine	DMM2NSK	Approved	Adenosine increases the expression of Myc proto-oncogene protein (MYC).	[63]
Mebendazole	DMO14SG	Approved	Mebendazole decreases the expression of Myc proto-oncogene protein (MYC).	[64]
Fructose	DM43AN2	Approved	Fructose decreases the expression of Myc proto-oncogene protein (MYC).	[65]
Clotrimazole	DMMFCIH	Approved	Clotrimazole decreases the expression of Myc proto-oncogene protein (MYC).	[66]
Nifedipine	DMSVOZT	Approved	Nifedipine increases the expression of Myc proto-oncogene protein (MYC).	[51]
Chlorambucil	DMRKE63	Approved	Chlorambucil increases the expression of Myc proto-oncogene protein (MYC).	[67]
Benzoic acid	DMKB9FI	Approved	Benzoic acid decreases the expression of Myc proto-oncogene protein (MYC).	[68]
Clofibrate	DMPC1J7	Approved	Clofibrate decreases the expression of Myc proto-oncogene protein (MYC).	[69]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid decreases the expression of Myc proto-oncogene protein (MYC).	[70]
Masoprocol	DMMVNZ0	Approved	Masoprocol increases the expression of Myc proto-oncogene protein (MYC).	[71]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate decreases the expression of Myc proto-oncogene protein (MYC).	[72]
Amsacrine	DMZKYIV	Approved	Amsacrine decreases the expression of Myc proto-oncogene protein (MYC).	[6]
Reserpine	DM6VM38	Approved	Reserpine decreases the expression of Myc proto-oncogene protein (MYC).	[73]
Vemurafenib	DM62UG5	Approved	Vemurafenib decreases the expression of Myc proto-oncogene protein (MYC).	[74]
Promegestone	DMK4S8I	Approved	Promegestone increases the expression of Myc proto-oncogene protein (MYC).	[75]
AC220	DM8Y4JS	Approved	AC220 decreases the expression of Myc proto-oncogene protein (MYC).	[76]
Trametinib	DM2JGQ3	Approved	Trametinib decreases the expression of Myc proto-oncogene protein (MYC).	[77]
Riboflavin	DM8YMWE	Approved	Riboflavin increases the expression of Myc proto-oncogene protein (MYC).	[78]
Teniposide	DMLW57T	Approved	Teniposide decreases the expression of Myc proto-oncogene protein (MYC).	[6]
Hexachlorophene	DMLKSE0	Approved	Hexachlorophene decreases the expression of Myc proto-oncogene protein (MYC).	[79]
Memantine	DMD9WSC	Approved	Memantine decreases the expression of Myc proto-oncogene protein (MYC).	[81]
Quinolones	DM5GVHU	Approved	Quinolones decreases the expression of Myc proto-oncogene protein (MYC).	[82]
Fedratinib	DM4ZBK6	Approved	Fedratinib decreases the expression of Myc proto-oncogene protein (MYC).	[83]
PF-03084014	DMUP5Z0	Approved	PF-03084014 decreases the expression of Myc proto-oncogene protein (MYC).	[84]
Tiazofurin	DM5JWV9	Approved	Tiazofurin decreases the expression of Myc proto-oncogene protein (MYC).	[85]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Myc proto-oncogene protein (MYC).	[86]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone decreases the expression of Myc proto-oncogene protein (MYC).	[87]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Myc proto-oncogene protein (MYC).	[88]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Myc proto-oncogene protein (MYC).	[89]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Myc proto-oncogene protein (MYC).	[90]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Myc proto-oncogene protein (MYC).	[91]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of Myc proto-oncogene protein (MYC).	[92]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Myc proto-oncogene protein (MYC).	[93]
Rigosertib	DMOSTXF	Phase 3	Rigosertib decreases the expression of Myc proto-oncogene protein (MYC).	[94]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of Myc proto-oncogene protein (MYC).	[95]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the expression of Myc proto-oncogene protein (MYC).	[96]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Myc proto-oncogene protein (MYC).	[97]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of Myc proto-oncogene protein (MYC).	[98]

References

• [1] Point mutations in the c-Myc transactivation domain are common in Burkitt's lymphoma and mouse plasmacytomas. Nat Genet. 1993 Sep;5(1):56-61. doi: 10.1038/ng0993-56.
• [2] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [5] Validation of reference gene stability for APAP hepatotoxicity studies in different in vitro systems and identification of novel potential toxicity biomarkers. Toxicol In Vitro. 2010 Oct;24(7):1962-70. doi: 10.1016/j.tiv.2010.08.007. Epub 2010 Aug 21.
• [6] Suppression of c-myc expression and c-Myc function in response to sustained DNA damage in MCF-7 breast tumor cells. Biochem Pharmacol. 2001 Sep 1;62(5):593-602. doi: 10.1016/s0006-2952(01)00699-2.
• [7] Toxicogenomics-based discrimination of toxic mechanism in HepG2 human hepatoma cells. Toxicol Sci. 2000 Dec;58(2):399-415.
• [8] Acetaminophen-induced proliferation of estrogen-responsive breast cancer cells is associated with increases in c-myc RNA expression and NF-kappaB activity. Toxicol Sci. 2002 Apr;66(2):233-43. doi: 10.1093/toxsci/66.2.233.
• [9] Quercetin, a potent inhibitor against beta-catenin/Tcf signaling in SW480 colon cancer cells. Biochem Biophys Res Commun. 2005 Mar 4;328(1):227-34. doi: 10.1016/j.bbrc.2004.12.151.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Arsenic inhibition of telomerase transcription leads to genetic instability. J Clin Invest. 2001 Nov;108(10):1541-7. doi: 10.1172/JCI14064.
• [12] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [13] Vitamin D receptor as a master regulator of the c-MYC/MXD1 network. Proc Natl Acad Sci U S A. 2012 Nov 13;109(46):18827-32. doi: 10.1073/pnas.1210037109. Epub 2012 Oct 29.
• [14] Therapeutic targeting of c-Myc in T-cell acute lymphoblastic leukemia, T-ALL. Oncotarget. 2014 May 30;5(10):3168-72. doi: 10.18632/oncotarget.1873.
• [15] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [16] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [17] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [18] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [19] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [20] Selenite and selenomethionine promote HL-60 cell cycle progression. J Nutr. 2002 Apr;132(4):674-9. doi: 10.1093/jn/132.4.674.
• [21] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [22] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [23] Molecular mechanisms of the antiproliferative effect of vitamin K3 on Jurkat cells. Biochemistry (Mosc). 1999 Apr;64(4):468-72.
• [24] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [25] Highly active combination of BRD4 antagonist and histone deacetylase inhibitor against human acute myelogenous leukemia cells. Mol Cancer Ther. 2014 May;13(5):1142-54.
• [26] Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
• [27] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [28] The autonomous notch signal pathway is activated by baicalin and baicalein but is suppressed by niclosamide in K562 cells. J Cell Biochem. 2009 Mar 1;106(4):682-92. doi: 10.1002/jcb.22065.
• [29] PCI-24781 induces caspase and reactive oxygen species-dependent apoptosis through NF-kappaB mechanisms and is synergistic with bortezomib in lymphoma cells. Clin Cancer Res. 2009 May 15;15(10):3354-65. doi: 10.1158/1078-0432.CCR-08-2365. Epub 2009 May 5.
• [30] Peroxisome proliferator-activated receptor ligands affect growth-related gene expression in human leukemic cells. J Pharmacol Exp Ther. 2003 Jun;305(3):932-42. doi: 10.1124/jpet.103.049098. Epub 2003 Mar 20.
• [31] Hypomethylation mediated by decreased DNMTs involves in the activation of proto-oncogene MPL in TK6 cells treated with hydroquinone. Toxicol Lett. 2012 Mar 25;209(3):239-45. doi: 10.1016/j.toxlet.2011.12.020. Epub 2012 Jan 8.
• [32] Analysis of gene expression induced by diethylstilbestrol (DES) in human primitive Mullerian duct cells using microarray. Cancer Lett. 2005 Apr 8;220(2):197-210.
• [33] [Proliferation and apoptosis effect of rosiglitazone on human ovarian cancer cell line SKOV3]. Sichuan Da Xue Xue Bao Yi Xue Ban. 2009 Mar;40(2):217-22.
• [34] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [35] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [36] Proteomic analysis of anti-cancer effects by paclitaxel treatment in cervical cancer cells. Gynecol Oncol. 2005 Jul;98(1):45-53. doi: 10.1016/j.ygyno.2005.04.010.
• [37] Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
• [38] Nitrosamines as nicotinic receptor ligands. Life Sci. 2007 May 30;80(24-25):2274-80. doi: 10.1016/j.lfs.2007.03.006. Epub 2007 Mar 19.
• [39] MEK/ERK dependent activation of STAT1 mediates dasatinib-induced differentiation of acute myeloid leukemia. PLoS One. 2013 Jun 25;8(6):e66915. doi: 10.1371/journal.pone.0066915. Print 2013.
• [40] Differential apoptosis by indomethacin in gastric epithelial cells through the constitutive expression of wild-type p53 and/or up-regulation of c-myc. Biochem Pharmacol. 1999 Jul 1;58(1):193-200. doi: 10.1016/s0006-2952(99)00058-1.
• [41] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [42] Alpha anomer of 5-aza-2'-deoxycytidine down-regulates hTERT mRNA expression in human leukemia HL-60 cells. Biochem Pharmacol. 2008 Feb 15;75(4):965-72. doi: 10.1016/j.bcp.2007.10.018. Epub 2007 Oct 22.
• [43] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [44] High-dose mitoxantrone induces programmed cell death or apoptosis in human myeloid leukemia cells. Blood. 1993 Nov 15;82(10):3133-40.
• [45] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [46] Novel detection and differential utilization of a c-myc transcriptional block in colon cancer chemoprevention. Cancer Res. 2002 Nov 1;62(21):6006-10.
• [47] Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
• [48] Palbociclib treatment of FLT3-ITD+ AML cells uncovers a kinase-dependent transcriptional regulation of FLT3 and PIM1 by CDK6. Blood. 2016 Jun 9;127(23):2890-902. doi: 10.1182/blood-2015-11-683581. Epub 2016 Apr 20.
• [49] Cardiotonic steroids attenuate ERK phosphorylation and generate cell cycle arrest to block human hepatoma cell growth. J Steroid Biochem Mol Biol. 2011 Jul;125(3-5):181-91. doi: 10.1016/j.jsbmb.2010.12.016. Epub 2011 Jan 6.
• [50] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [51] Immunolocalizaiton of c-Myc and bcl-2 proto-oncogene products in gingival hyperplasia induced by nifedipine and phenytoin. J Periodontol. 2000 Jan;71(1):44-9. doi: 10.1902/jop.2000.71.1.44.
• [52] Inhibition of the erythropoietin-producing receptor EPHB4 antagonizes androgen receptor overexpression and reduces enzalutamide resistance. J Biol Chem. 2020 Apr 17;295(16):5470-5483. doi: 10.1074/jbc.RA119.011385. Epub 2020 Mar 17.
• [53] ZD1839 induces p15INK4b and causes G1 arrest by inhibiting the mitogen-activated protein kinase/extracellular signal-regulated kinase pathway. Mol Cancer Ther. 2007 May;6(5):1579-87. doi: 10.1158/1535-7163.MCT-06-0814.
• [54] Fluoxetine inhibits the extracellular signal regulated kinase pathway and suppresses growth of cancer cells. Cancer Biol Ther. 2008 Oct;7(10):1685-93. doi: 10.4161/cbt.7.10.6664. Epub 2008 Oct 22.
• [55] Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
• [56] Efficient intervention of growth and infiltration of primary adult T-cell leukemia cells by an HIV protease inhibitor, ritonavir. Blood. 2006 Jan 15;107(2):716-24. doi: 10.1182/blood-2005-02-0735. Epub 2005 Sep 20.
• [57] Structurally diverse c-Myc inhibitors share a common mechanism of action involving ATP depletion. Oncotarget. 2015 Jun 30;6(18):15857-70. doi: 10.18632/oncotarget.4327.
• [58] Prostaglandin E2 induces apoptosis in resting immature and mature human lymphocytes: a c-Myc-dependent and Bcl-2-independent associated pathway. J Pharmacol Exp Ther. 1996 Jun;277(3):1793-800.
• [59] Response rate of fibrosarcoma cells to cytotoxic drugs on the expression level correlates to the therapeutic response rate of fibrosarcomas and is mediated by regulation of apoptotic pathways. BMC Cancer. 2005 Jul 7;5:74. doi: 10.1186/1471-2407-5-74.
• [60] Effect of heparin on apoptosis in human nasopharyngeal carcinoma CNE2 cells. Cell Res. 2001 Dec;11(4):311-5. doi: 10.1038/sj.cr.7290101.
• [61] Retinol decreases beta-catenin protein levels in retinoic acid-resistant colon cancer cell lines. Mol Carcinog. 2007 Apr;46(4):315-29. doi: 10.1002/mc.20280.
• [62] The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
• [63] Adenosine and Cordycepin Accelerate Tissue Remodeling Process through Adenosine Receptor Mediated Wnt/-Catenin Pathway Stimulation by Regulating GSK3b Activity. Int J Mol Sci. 2021 May 25;22(11):5571. doi: 10.3390/ijms22115571.
• [64] Mebendazole induces apoptosis via C-MYC inactivation in malignant ascites cell line (AGP01). Toxicol In Vitro. 2019 Oct;60:305-312. doi: 10.1016/j.tiv.2019.06.010. Epub 2019 Jun 14.
• [65] c-myc gene expression in human cells is controlled by glucose. Biochem Biophys Res Commun. 1989 Dec 29;165(3):1123-9. doi: 10.1016/0006-291x(89)92719-8.
• [66] Effects of clotrimazole on the growth, morphological characteristics, and cisplatin sensitivity of human glioblastoma cells in vitro. J Neurosurg. 1999 May;90(5):918-27. doi: 10.3171/jns.1999.90.5.0918.
• [67] Theophylline synergizes with chlorambucil in inducing apoptosis of B-chronic lymphocytic leukemia cells. Blood. 1996 Sep 15;88(6):2172-82.
• [68] Hydroxamic Acid and Benzoic Acid-Based STAT3 Inhibitors Suppress Human Glioma and Breast Cancer Phenotypes In Vitro and In Vivo. Cancer Res. 2016 Feb 1;76(3):652-63. doi: 10.1158/0008-5472.CAN-14-3558. Epub 2015 Jun 18.
• [69] Steroid receptor coactivator 1 deficiency increases MMTV-neu mediated tumor latency and differentiation specific gene expression, decreases metastasis, and inhibits response to PPAR ligands. BMC Cancer. 2010 Nov 16;10:629. doi: 10.1186/1471-2407-10-629.
• [70] A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands. Breast Cancer Res. 2004;6(5):R546-55. doi: 10.1186/bcr913. Epub 2004 Jul 23.
• [71] Inhibition of AP-1 transcription activator induces myc-dependent apoptosis in HL60 cells. J Cell Biochem. 2004 Apr 1;91(5):973-86. doi: 10.1002/jcb.10768.
• [72] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [73] Isoreserpine promotes beta-catenin degradation via Siah-1 up-regulation in HCT116 colon cancer cells. Biochem Biophys Res Commun. 2009 Sep 25;387(3):444-9. doi: 10.1016/j.bbrc.2009.07.027. Epub 2009 Jul 14.
• [74] Perturbation biology nominates upstream-downstream drug combinations in RAF inhibitor resistant melanoma cells. Elife. 2015 Aug 18;4:e04640. doi: 10.7554/eLife.04640.
• [75] Two chromatin remodeling activities cooperate during activation of hormone responsive promoters. PLoS Genet. 2009 Jul;5(7):e1000567. doi: 10.1371/journal.pgen.1000567. Epub 2009 Jul 17.
• [76] BET protein antagonist JQ1 is synergistically lethal with FLT3 tyrosine kinase inhibitor (TKI) and overcomes resistance to FLT3-TKI in AML cells expressing FLT-ITD. Mol Cancer Ther. 2014 Oct;13(10):2315-27. doi: 10.1158/1535-7163.MCT-14-0258. Epub 2014 Jul 22.
• [77] Combination small molecule MEK and PI3K inhibition enhances uveal melanoma cell death in a mutant GNAQ- and GNA11-dependent manner. Clin Cancer Res. 2012 Aug 15;18(16):4345-55. doi: 10.1158/1078-0432.CCR-11-3227. Epub 2012 Jun 25.
• [78] [Apoptosis of human gastric cancer cell induced by photochemical riboflavin]. Ai Zheng. 2003 Mar;22(3):253-6.
• [79] Hexachlorophene inhibits Wnt/beta-catenin pathway by promoting Siah-mediated beta-catenin degradation. Mol Pharmacol. 2006 Sep;70(3):960-6. doi: 10.1124/mol.106.024729. Epub 2006 May 30.
• [80] Role of the redox protein thioredoxin in cytoprotective mechanism evoked by (-)-deprenyl. Mol Pharmacol. 2005 Nov;68(5):1408-14. doi: 10.1124/mol.105.012302. Epub 2005 Aug 12.
• [81] Memantine induces apoptosis and inhibits cell cycle progression in LNCaP prostate cancer cells. Hum Exp Toxicol. 2018 Sep;37(9):953-958. doi: 10.1177/0960327117747025. Epub 2017 Dec 11.
• [82] Design of nucleotide-mimetic and non-nucleotide inhibitors of the translation initiation factor eIF4E: Synthesis, structural and functional characterisation. Eur J Med Chem. 2016 Nov 29;124:200-217. doi: 10.1016/j.ejmech.2016.08.047. Epub 2016 Aug 24.
• [83] Differences in gene expression and alterations in cell cycle of acute myeloid leukemia cell lines after treatment with JAK inhibitors. Eur J Pharmacol. 2015 Oct 15;765:188-97. doi: 10.1016/j.ejphar.2015.08.037. Epub 2015 Aug 20.
• [84] NOTCH signaling is activated in and contributes to resistance in enzalutamide-resistant prostate cancer cells. J Biol Chem. 2019 May 24;294(21):8543-8554. doi: 10.1074/jbc.RA118.006983. Epub 2019 Apr 2.
• [85] Regulation of the signal transduction program by drugs. Adv Enzyme Regul. 1997;37:35-55. doi: 10.1016/s0065-2571(96)00025-8.
• [86] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [87] Therapeutic targeting of BET bromodomain proteins in castration-resistant prostate cancer. Nature. 2014 Jun 12;510(7504):278-82. doi: 10.1038/nature13229. Epub 2014 Apr 23.
• [88] 4-(E)-{(p-tolylimino)-methylbenzene-1,2-diol}, 1 a novel resveratrol analog, differentially regulates estrogen receptors and in breast cancer cells. Toxicol Appl Pharmacol. 2016 Jun 15;301:1-13. doi: 10.1016/j.taap.2016.03.003. Epub 2016 Mar 9.
• [89] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [90] Resveratrol-induced modification of polyamine metabolism is accompanied by induction of c-Fos. Carcinogenesis. 2003 Mar;24(3):469-74. doi: 10.1093/carcin/24.3.469.
• [91] Antitumor effects of curcumin, alone or in combination with cisplatin or doxorubicin, on human hepatic cancer cells. Analysis of their possible relationship to changes in NF-kB activation levels and in IAP gene expression. Cancer Lett. 2005 Jun 16;224(1):53-65. doi: 10.1016/j.canlet.2004.10.051.
• [92] Regulation of apoptosis induced by the retinoid N-(4-hydroxyphenyl) retinamide and effect of deregulated bcl-2. Blood. 1995 Jan 15;85(2):359-67.
• [93] Camptothecin enhances c-Myc-mediated endoplasmic reticulum stress and leads to autophagy by activating Ca(2+)-mediated AMPK. Food Chem Toxicol. 2018 Nov;121:648-656. doi: 10.1016/j.fct.2018.09.057. Epub 2018 Sep 25.
• [94] Styryl sulfonyl compounds inhibit translation of cyclin D1 in mantle cell lymphoma cells. Oncogene. 2009 Mar 26;28(12):1518-28. doi: 10.1038/onc.2008.502. Epub 2009 Feb 9.
• [95] The antipsychotic chlorpromazine suppresses YAP signaling, stemness properties, and drug resistance in breast cancer cells. Chem Biol Interact. 2019 Apr 1;302:28-35. doi: 10.1016/j.cbi.2019.01.033. Epub 2019 Jan 28.
• [96] Atorvastatin induces MicroRNA-145 expression in HEPG2 cells via regulation of the PI3K/AKT signalling pathway. Chem Biol Interact. 2018 May 1;287:32-40. doi: 10.1016/j.cbi.2018.04.005. Epub 2018 Apr 6.
• [97] Andrographolide inhibits the growth of human osteosarcoma cells by suppressing Wnt/-catenin, PI3K/AKT and NF-B signaling pathways. Chem Biol Interact. 2022 Sep 25;365:110068. doi: 10.1016/j.cbi.2022.110068. Epub 2022 Jul 31.
• [98] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [99] Triplex-forming oligonucleotides targeting c-MYC potentiate the anti-tumor activity of gemcitabine in a mouse model of human cancer. Mol Carcinog. 2014 Sep;53(9):744-52. doi: 10.1002/mc.22026. Epub 2013 May 16.
• [100] c-myc antisense oligonucleotides sensitize human colorectal cancer cells to chemotherapeutic drugs. Tumour Biol. 2008;29(5):287-303. doi: 10.1159/000156706. Epub 2008 Sep 19.
• [101] Glutathione influences c-Myc-induced apoptosis in M14 human melanoma cells. J Biol Chem. 2002 Nov 15;277(46):43763-70. doi: 10.1074/jbc.M207684200. Epub 2002 Sep 10.
• [102] Gamma-glutamylcysteine synthetase mediates the c-Myc-dependent response to antineoplastic agents in melanoma cells. Mol Pharmacol. 2007 Oct;72(4):1015-23. doi: 10.1124/mol.107.038687. Epub 2007 Jul 12.
• [103] Disruption of the MYC-miRNA-EZH2 loop to suppress aggressive B-cell lymphoma survival and clonogenicity. Leukemia. 2013 Dec;27(12):2341-50. doi: 10.1038/leu.2013.94. Epub 2013 Mar 29.
• [104] Anti-tumor effects by a synthetic chalcone compound is mediated by c-Myc-mediated reactive oxygen species production. Chem Biol Interact. 2010 Oct 6;188(1):111-8. doi: 10.1016/j.cbi.2010.06.016. Epub 2010 Jul 8.