Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS2DVDW)

• DOT Name: MHC class I polypeptide-related sequence B (MICB)
• Synonyms: MIC-B
• Gene Name: MICB
• Related Disease:
  Classic Hodgkin lymphoma
  Multiple sclerosis
  Respiratory syncytial virus infection
  Alzheimer disease
  Asthma
  Autoimmune disease
  Barrett esophagus
  Bone osteosarcoma
  Coeliac disease
  Esophageal squamous cell carcinoma
  Gastric cancer
  Herpes simplex infection
  Major depressive disorder
  Melanoma
  Myasthenia gravis
  Neoplasm
  Non-small-cell lung cancer
  Osteosarcoma
  Pancreatic cancer
  Primary sclerosing cholangitis
  Psoriatic arthritis
  Rheumatoid arthritis
  Squamous cell carcinoma
  Stomach cancer
  Systemic lupus erythematosus
  Tuberculosis
  Alcohol dependence
  Alcohol-induced disorders
  Alcohol-related disorders
  Breast cancer
  Breast carcinoma
  MALT lymphoma
  Cervical cancer
  Cervical carcinoma
  Plasma cell myeloma
  Behcet disease
  Colorectal carcinoma
  Hepatitis C virus infection
  Inflammatory bowel disease
  Myositis disease
  Schizophrenia
• UniProt ID: MICB_HUMAN
• PDB ID: 1JE6; 2WY3
• Pfam ID: PF07654 ; PF00129
• Sequence:
  MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
  RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
  IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
  RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
  QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
  LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
  DAAQLGFQPLMSATGSTGSTEGT
• Function: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
• Tissue Specificity: Widely expressed with the exception of the central nervous system where it is absent. Expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In hepatocellular carcinomas, expressed in tumor cells but not in surrounding non-cancerous tissue.
• KEGG Pathway:
  .tural killer cell mediated cytotoxicity (hsa04650)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
• Reactome Pathway: Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Classic Hodgkin lymphoma	DISV1LU6	Definitive	Genetic Variation	[1]
Multiple sclerosis	DISB2WZI	Definitive	Biomarker	[2]
Respiratory syncytial virus infection	DIS7FWHY	Definitive	Genetic Variation	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Asthma	DISW9QNS	Strong	Genetic Variation	[5]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[6]
Barrett esophagus	DIS416Y7	Strong	Biomarker	[7]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[8]
Coeliac disease	DISIY60C	Strong	Genetic Variation	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[10]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[11]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[12]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[5]
Melanoma	DIS1RRCY	Strong	Biomarker	[13]
Myasthenia gravis	DISELRCI	Strong	Genetic Variation	[14]
Neoplasm	DISZKGEW	Strong	Altered Expression	[15]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[16]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[8]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[17]
Primary sclerosing cholangitis	DISTH5WJ	Strong	Biomarker	[18]
Psoriatic arthritis	DISLWTG2	Strong	Genetic Variation	[19]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[21]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[11]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[22]
Tuberculosis	DIS2YIMD	Strong	Genetic Variation	[23]
Alcohol dependence	DIS4ZSCO	moderate	Genetic Variation	[24]
Alcohol-induced disorders	DIS3SFYT	moderate	Genetic Variation	[24]
Alcohol-related disorders	DIS3K4KK	moderate	Genetic Variation	[24]
Breast cancer	DIS7DPX1	moderate	Biomarker	[25]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[25]
MALT lymphoma	DIS1AVVE	moderate	Genetic Variation	[26]
Cervical cancer	DISFSHPF	Disputed	Biomarker	[27]
Cervical carcinoma	DIST4S00	Disputed	Biomarker	[27]
Plasma cell myeloma	DIS0DFZ0	Disputed	Altered Expression	[28]
Behcet disease	DISSYMBS	Limited	Genetic Variation	[29]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[30]
Hepatitis C virus infection	DISQ0M8R	Limited	Genetic Variation	[31]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[32]
Myositis disease	DISCIXF0	Limited	Genetic Variation	[33]
Schizophrenia	DISSRV2N	Limited	Biomarker	[34]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	MHC class I polypeptide-related sequence B (MICB) affects the response to substance of Fluorouracil.	[60]
Paclitaxel	DMLB81S	Approved	MHC class I polypeptide-related sequence B (MICB) increases the response to substance of Paclitaxel.	[61]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of MHC class I polypeptide-related sequence B (MICB).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of MHC class I polypeptide-related sequence B (MICB).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of MHC class I polypeptide-related sequence B (MICB).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of MHC class I polypeptide-related sequence B (MICB).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of MHC class I polypeptide-related sequence B (MICB).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of MHC class I polypeptide-related sequence B (MICB).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of MHC class I polypeptide-related sequence B (MICB).	[41]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of MHC class I polypeptide-related sequence B (MICB).	[36]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of MHC class I polypeptide-related sequence B (MICB).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of MHC class I polypeptide-related sequence B (MICB).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of MHC class I polypeptide-related sequence B (MICB).	[45]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of MHC class I polypeptide-related sequence B (MICB).	[46]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of MHC class I polypeptide-related sequence B (MICB).	[47]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of MHC class I polypeptide-related sequence B (MICB).	[48]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of MHC class I polypeptide-related sequence B (MICB).	[49]
Gefitinib	DM15F0X	Approved	Gefitinib increases the expression of MHC class I polypeptide-related sequence B (MICB).	[50]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of MHC class I polypeptide-related sequence B (MICB).	[51]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of MHC class I polypeptide-related sequence B (MICB).	[48]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of MHC class I polypeptide-related sequence B (MICB).	[52]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of MHC class I polypeptide-related sequence B (MICB).	[54]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of MHC class I polypeptide-related sequence B (MICB).	[55]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of MHC class I polypeptide-related sequence B (MICB).	[56]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of MHC class I polypeptide-related sequence B (MICB).	[57]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of MHC class I polypeptide-related sequence B (MICB).	[58]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of MHC class I polypeptide-related sequence B (MICB).	[59]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of MHC class I polypeptide-related sequence B (MICB).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of MHC class I polypeptide-related sequence B (MICB).	[53]

References

• [1] Variation at 3p24.1 and 6q23.3 influences the risk of Hodgkin's lymphoma.Nat Commun. 2013;4:2549. doi: 10.1038/ncomms3549.
• [2] Integrative analysis revealed potential causal genetic and epigenetic factors for multiple sclerosis.J Neurol. 2019 Nov;266(11):2699-2709. doi: 10.1007/s00415-019-09476-w. Epub 2019 Jul 18.
• [3] The association between MICA/MICB polymorphism and respiratory syncytial virus infection in children.Int J Immunogenet. 2017 Dec;44(6):328-336. doi: 10.1111/iji.12338. Epub 2017 Sep 18.
• [4] Identification of prefrontal cortex protein alterations in Alzheimer's disease.Oncotarget. 2018 Jan 24;9(13):10847-10867. doi: 10.18632/oncotarget.24303. eCollection 2018 Feb 16.
• [5] Shared genetics of asthma and mental health disorders: a large-scale genome-wide cross-trait analysis.Eur Respir J. 2019 Dec 19;54(6):1901507. doi: 10.1183/13993003.01507-2019. Print 2019 Dec.
• [6] MICB0106 gene polymorphism is associated with ulcerative colitis in central China.Int J Colorectal Dis. 2010 Feb;25(2):153-9. doi: 10.1007/s00384-009-0787-y. Epub 2009 Aug 7.
• [7] Genome-wide association study identifies new susceptibility loci for cutaneous lupus erythematosus.Exp Dermatol. 2015 Jul;24(7):510-5. doi: 10.1111/exd.12708. Epub 2015 May 4.
• [8] Hypoxia downregulates the expression of cell surface MICA without increasing soluble MICA in osteosarcoma cells in a HIF-1-dependent manner.Int J Oncol. 2012 Dec;41(6):2005-12. doi: 10.3892/ijo.2012.1630. Epub 2012 Sep 18.
• [9] MHC class I chain-related gene B promoter polymorphisms and celiac disease.Hum Immunol. 2006 Mar;67(3):208-14. doi: 10.1016/j.humimm.2006.02.011. Epub 2006 Mar 29.
• [10] Implication of Highly Cytotoxic Natural Killer Cells for Esophageal Squamous Cell Carcinoma Treatment.J Immunother. 2018 Jul/Aug;41(6):261-273. doi: 10.1097/CJI.0000000000000227.
• [11] Clinical significance of tumor expression of major histocompatibility complex class I-related chains A and B (MICA/B) in gastric cancer patients.Oncol Rep. 2016 Mar;35(3):1309-17. doi: 10.3892/or.2015.4510. Epub 2015 Dec 23.
• [12] Polymorphisms in MICB are associated with human herpes virus seropositivity and schizophrenia risk.Schizophr Res. 2007 Aug;94(1-3):342-53. doi: 10.1016/j.schres.2007.04.021. Epub 2007 Jun 11.
• [13] Natural killer cell-based immunotherapy: a new fighter against melanoma?.Melanoma Res. 2019 Apr;29(2):208-211. doi: 10.1097/CMR.0000000000000552.
• [14] Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
• [15] Bortezomib Augments Natural Killer Cell Targeting of Stem-Like Tumor Cells.Cancers (Basel). 2019 Jan 14;11(1):85. doi: 10.3390/cancers11010085.
• [16] Estrogen upregulates MICA/B expression in human non-small cell lung cancer through the regulation of ADAM17.Cell Mol Immunol. 2015 Nov;12(6):768-76. doi: 10.1038/cmi.2014.101. Epub 2014 Nov 3.
• [17] Valproic acid sensitizes pancreatic cancer cells to natural killer cell-mediated lysis by upregulating MICA and MICB via the PI3K/Akt signaling pathway.BMC Cancer. 2014 May 25;14:370. doi: 10.1186/1471-2407-14-370.
• [18] Primary sclerosing cholangitis is associated to an extended B8-DR3 haplotype including particular MICA and MICB alleles.Hepatology. 2001 Oct;34(4 Pt 1):625-30. doi: 10.1053/jhep.2001.27543.
• [19] MICA rather than MICB, TNFA, or HLA-DRB1 is associated with susceptibility to psoriatic arthritis.J Rheumatol. 2002 May;29(5):973-8.
• [20] MICB*002 and MICB*014 protect against rheumatoid arthritis, whereas MICA*009 and MICA*A6 are associated with rheumatoid arthritis in a Hainan Han Chinese population.Int J Rheum Dis. 2019 Jan;22(1):90-95. doi: 10.1111/1756-185X.13302. Epub 2018 Apr 17.
• [21] MICA and MICB overexpression in oral squamous cell carcinoma.J Oral Pathol Med. 2007 Jan;36(1):43-7. doi: 10.1111/j.1600-0714.2006.00471.x.
• [22] Association Between Major Histocompatibility Complex Class I Chain-Related Gene Polymorphisms and Susceptibility of Systemic Lupus Erythematosus.Am J Med Sci. 2017 Oct;354(4):430-435. doi: 10.1016/j.amjms.2017.06.003. Epub 2017 Jun 12.
• [23] Positive association between MIC gene polymorphism and tuberculosis in Chinese population.Immunol Lett. 2019 Sep;213:62-69. doi: 10.1016/j.imlet.2019.07.008. Epub 2019 Aug 7.
• [24] Genome-wide association study of alcohol consumption and use disorder in 274,424 individuals from multiple populations.Nat Commun. 2019 Apr 2;10(1):1499. doi: 10.1038/s41467-019-09480-8.
• [25] HER2/HER3 signaling regulates NK cell-mediated cytotoxicity via MHC class I chain-related molecule A and B expression in human breast cancer cell lines.J Immunol. 2012 Mar 1;188(5):2136-45. doi: 10.4049/jimmunol.1102237. Epub 2012 Feb 1.
• [26] Eight novel MICB alleles, including a null allele, identified in gastric MALT lymphoma patients.Tissue Antigens. 2004 Sep;64(3):276-80. doi: 10.1111/j.1399-0039.2004.00286.x.
• [27] Associations of MICB with cervical cancer in north-eastern Thais: identification of major histocompatibility complex class I chain-related gene B motifs influencing natural killer cell activation.Clin Exp Immunol. 2008 Aug;153(2):205-13. doi: 10.1111/j.1365-2249.2008.03682.x. Epub 2008 May 26.
• [28] Activation of liver X receptor up-regulates the expression of the NKG2D ligands MICA and MICB in multiple myeloma through different molecular mechanisms.FASEB J. 2019 Aug;33(8):9489-9504. doi: 10.1096/fj.201900319R. Epub 2019 May 24.
• [29] Identification of a susceptibility locus in STAT4 for Behet's disease in Han Chinese in a genome-wide association study.Arthritis Rheum. 2012 Dec;64(12):4104-13. doi: 10.1002/art.37708.
• [30] Association of MICA-TM and MICB C1_2_A microsatellite polymorphisms with tumor progression in patients with colorectal cancer.J Clin Immunol. 2009 Jul;29(4):545-54. doi: 10.1007/s10875-009-9288-6. Epub 2009 Apr 8.
• [31] The haplotype block, NFKBIL1-ATP6V1G2-BAT1-MICB-MICA, within the class III-class I boundary region of the human major histocompatibility complex may control susceptibility to hepatitis C virus-associated dilated cardiomyopathy.Tissue Antigens. 2005 Sep;66(3):200-8. doi: 10.1111/j.1399-0039.2005.00457.x.
• [32] Epidemiology and gene markers of ulcerative colitis in the Chinese.World J Gastroenterol. 2009 Feb 21;15(7):788-803. doi: 10.3748/wjg.15.788.
• [33] Genome-wide association study identifies HLA 8.1 ancestral haplotype alleles as major genetic risk factors for myositis phenotypes.Genes Immun. 2015 Oct;16(7):470-80. doi: 10.1038/gene.2015.28. Epub 2015 Aug 20.
• [34] Handedness, language areas and neuropsychiatric diseases: insights from brain imaging and genetics.Brain. 2019 Oct 1;142(10):2938-2947. doi: 10.1093/brain/awz257.
• [35] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [36] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [37] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [38] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [41] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [42] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [43] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [44] Induction of NKG2D ligands and subsequent enhancement of NK cell-mediated lysis of cancer cells by arsenic trioxide. J Immunother. 2008 Jun;31(5):475-86. doi: 10.1097/CJI.0b013e3181755deb.
• [45] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [46] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [47] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [48] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [49] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [50] Susceptibility to natural killer cell-mediated lysis of colon cancer cells is enhanced by treatment with epidermal growth factor receptor inhibitors through UL16-binding protein-1 induction. Cancer Sci. 2012 Jan;103(1):7-16. doi: 10.1111/j.1349-7006.2011.02109.x. Epub 2011 Nov 15.
• [51] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [52] Resveratrol sensitized leukemia stem cell-like KG-1a cells to cytokine-induced killer cells-mediated cytolysis through NKG2D ligands and TRAIL receptors. Cancer Biol Ther. 2012 May;13(7):516-26. doi: 10.4161/cbt.19601. Epub 2012 May 1.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [55] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [56] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [57] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [58] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [59] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [60] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [61] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.