Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSIMMC9)

• DOT Name: Serine/arginine repetitive matrix protein 2 (SRRM2)
• Synonyms: 300 kDa nuclear matrix antigen; Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa; SR-related nuclear matrix protein of 300 kDa; Ser/Arg-related nuclear matrix protein of 300 kDa; Splicing coactivator subunit SRm300; Tax-responsive enhancer element-binding protein 803; TaxREB803
• Gene Name: SRRM2
• Related Disease:
  Intellectual developmental disorder, autosomal dominant 72
  Melanoma
  Acute myelogenous leukaemia
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Arteriosclerosis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cervical cancer
  Cervical carcinoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Diabetic kidney disease
  Endometriosis
  Epithelial ovarian cancer
  Esophageal cancer
  Frontotemporal dementia
  Glioblastoma multiforme
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Intellectual disability
  Liver cancer
  Liver cirrhosis
  Lung neoplasm
  Neoplasm
  Nervous system inflammation
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Squamous cell carcinoma
  Stomach cancer
  Lung cancer
  Lung carcinoma
  Nasopharyngeal carcinoma
  Teratoma
  Fragile X syndrome
  Pancreatic cancer
  Thyroid gland papillary carcinoma
• UniProt ID: SRRM2_HUMAN
• PDB ID: 5MQF; 5XJC; 5YZG; 5Z56; 5Z57; 6FF4; 6FF7; 6ICZ; 6QDV; 6ZYM; 7A5P; 7DVQ; 7QTT; 7W59; 7W5A; 7W5B; 8C6J; 8CH6
• Pfam ID: PF08312
• Sequence:
  MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALVKRPNPDILDH
  ERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKDVNPGGKEETPGQRPAVTE
  THQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEPPKPYSLVRESSSS
  RSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKS
  KDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPAS
  GRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRPSPSPERSSTG
  PEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPTRDRSPPKSPEKLPQSSSSES
  SPPSPQPTKVSRHASSSPESPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRR
  MGRSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRP
  GWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPT
  RRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSRS
  RTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQR
  RGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLS
  GSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSP
  HPKVKSGTPPRQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVK
  SSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRSRSVSPCSNVE
  SRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVKAQTPPGPSLSGSKSPCPQEK
  SKDSLVQSCPGSLSLCAGVKSSTPPGESYFGVSSLQLKGQSQTSPDHRSDTSSPEVRQSH
  SESPSLQSKSQTSPKGGRSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQS
  DSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSL
  VFKDTLRTPPRERSGAGSSPETKEQNSALPTSSQDEELMEVVEKSEEPAGQILSHLSSEL
  KEMSTSNFESSPEVEERPAVSLTLDQSQSQASLEAVEVPSMASSWGGPHFSPEHKELSNS
  PLRENSFGSPLEFRNSGPLGTEMNTGFSSEVKEDLNGPFLNQLETDPSLDMKEQSTRSSG
  HSSSELSPDAVEKAGMSSNQSISSPVLDAVPRTPSRERSSSASSPEMKDGLPRTPSRRSR
  SGSSPGLRDGSGTPSRHSLSGSSPGMKDIPRTPSRGRSECDSSPEPKALPQTPRPRSRSP
  SSPELNNKCLTPQRERSGSESSVDQKTVARTPLGQRSRSGSSQELDVKPSASPQERSESD
  SSPDSKAKTRTPLRQRSRSGSSPEVDSKSRLSPRRSRSGSSPEVKDKPRAAPRAQSGSDS
  SPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGSRSSPEPKT
  KSRTPPRRRSSRSSPELTRKARLSRRSRSASSSPETRSRTPPRHRRSPSVSSPEPAEKSR
  SSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRR
  RQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTSSRRRRGRSRTPPTSRKRSRSRTSPAP
  WKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVTRRRSRSRASPVSR
  RRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRR
  RSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRK
  RSRSRSPLAIRRRSRSRTPRTARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHS
  GSRTPPVALNSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSSRTPMSVLQQAGGSMMDGP
  GPRIPDHQRTSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSL
  RTAPAANLASRIPAASAAAMNLASARTPAIPTAVNLADSRTPAAAAAMNLASPRTAVAPS
  AVNLADPRTPTAPAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRTPQAPASANLVG
  PRSAHATAPVNIAGSRTAAALAPASLTSARMAPALSGANLTSPRVPLSAYERVSGRTSPP
  LLDRARSRTPPSAPSQSRMTSERAPSPSSRMGQAPSQSLLPPAQDQPRSPVPSAFSDQSR
  CLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEPPASTGAQQPSA
  LAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPVQPEVALKRVP
  SPTPAPKEAVREGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
  SSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRR
  PSPQPSPRDQQSSSSERGSRRGQRGDSRSPSHKRRRETPSPRPMRHRSSRSP
• Function: Required for pre-mRNA splicing as component of the spliceosome. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable).
• Tissue Specificity: Expressed in liver, placenta, and white blood cells.
• Reactome Pathway: mRNA Splicing - Major Pathway (R-HSA-72163)

Molecular Interaction Atlas (MIA) of This DOT

51 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Intellectual developmental disorder, autosomal dominant 72	DISCZRTM	Definitive	Autosomal dominant	[1]
Melanoma	DIS1RRCY	Definitive	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[3]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[7]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[8]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[10]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[11]
Cervical cancer	DISFSHPF	Strong	Biomarker	[12]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[12]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[16]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[17]
Endometriosis	DISX1AG8	Strong	Biomarker	[18]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[19]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[20]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[21]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[4]
Glioma	DIS5RPEH	Strong	Biomarker	[22]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[23]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[24]
Intellectual disability	DISMBNXP	Strong	Biomarker	[25]
Liver cancer	DISDE4BI	Strong	Altered Expression	[26]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[11]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[27]
Neoplasm	DISZKGEW	Strong	Biomarker	[28]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[29]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[30]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[19]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[19]
Parkinson disease	DISQVHKL	Strong	Biomarker	[31]
Prostate cancer	DISF190Y	Strong	Biomarker	[32]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[32]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[33]
Stomach cancer	DISKIJSX	Strong	Biomarker	[34]
Lung cancer	DISCM4YA	moderate	Biomarker	[35]
Lung carcinoma	DISTR26C	moderate	Biomarker	[35]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[36]
Teratoma	DIS6ICY4	moderate	Altered Expression	[37]
Fragile X syndrome	DISE8W3A	Limited	Altered Expression	[38]
Pancreatic cancer	DISJC981	Limited	Biomarker	[39]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Genetic Variation	[40]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[41]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[43]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[44]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[45]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[48]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[49]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[50]
Marinol	DM70IK5	Approved	Marinol increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[51]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[52]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[53]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[54]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[55]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[57]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[59]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[60]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[61]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[62]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[64]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Serine/arginine repetitive matrix protein 2 (SRRM2).	[65]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Serine/arginine repetitive matrix protein 2 (SRRM2).	[46]
Quercetin	DM3NC4M	Approved	Quercetin affects the phosphorylation of Serine/arginine repetitive matrix protein 2 (SRRM2).	[47]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Serine/arginine repetitive matrix protein 2 (SRRM2).	[56]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Serine/arginine repetitive matrix protein 2 (SRRM2).	[47]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Serine/arginine repetitive matrix protein 2 (SRRM2).	[47]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Serine/arginine repetitive matrix protein 2 (SRRM2).	[63]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Extracellular vesicle-dependent effect of RNA-binding protein IGF2BP1 on melanoma metastasis.Oncogene. 2019 May;38(21):4182-4196. doi: 10.1038/s41388-019-0797-3. Epub 2019 Apr 1.
• [3] Targeting an RNA-Binding Protein Network in Acute Myeloid Leukemia.Cancer Cell. 2019 Mar 18;35(3):369-384.e7. doi: 10.1016/j.ccell.2019.01.010. Epub 2019 Feb 21.
• [4] RNA-Binding Protein Musashi1 Is a Central Regulator of Adhesion Pathways in Glioblastoma.Mol Cell Biol. 2015 Sep 1;35(17):2965-78. doi: 10.1128/MCB.00410-15. Epub 2015 Jun 22.
• [5] RNA-Binding Protein HuR Regulates Both Mutant and Wild-Type IDH1 in IDH1-Mutated Cancer.Mol Cancer Res. 2019 Feb;17(2):508-520. doi: 10.1158/1541-7786.MCR-18-0557. Epub 2018 Sep 28.
• [6] Amyloid precursor protein, an androgen-regulated gene, is targeted by RNA-binding protein PSF/SFPQ in neuronal cells.Genes Cells. 2019 Nov;24(11):719-730. doi: 10.1111/gtc.12721. Epub 2019 Oct 15.
• [7] Single-copy expression of an amyotrophic lateral sclerosis-linked TDP-43 mutation (M337V) in BAC transgenic mice leads to altered stress granule dynamics and progressive motor dysfunction.Neurobiol Dis. 2019 Jan;121:148-162. doi: 10.1016/j.nbd.2018.09.024. Epub 2018 Oct 2.
• [8] Endothelial HuR deletion reduces the expression of proatherogenic molecules and attenuates atherosclerosis.Int Immunopharmacol. 2018 Dec;65:248-255. doi: 10.1016/j.intimp.2018.09.023. Epub 2018 Oct 17.
• [9] Cell type-restricted activity of hnRNPM promotes breast cancer metastasis via regulating alternative splicing.Genes Dev. 2014 Jun 1;28(11):1191-203. doi: 10.1101/gad.241968.114. Epub 2014 May 19.
• [10] Role of the RNA-binding protein HuR in colon carcinogenesis.Oncogene. 2003 Oct 16;22(46):7146-54. doi: 10.1038/sj.onc.1206862.
• [11] Aberrant expression of fetal RNA-binding protein p62 in liver cancer and liver cirrhosis.Am J Pathol. 2001 Sep;159(3):945-53. doi: 10.1016/S0002-9440(10)61770-1.
• [12] Msi1 promotes tumor growth and cell proliferation by targeting cell cycle checkpoint proteins p21, p27 and p53 in cervical carcinomas.Oncotarget. 2014 Nov 15;5(21):10870-85. doi: 10.18632/oncotarget.2539.
• [13] Role of the RNA-binding protein HuR in human renal cell carcinoma.Carcinogenesis. 2010 Jun;31(6):1018-26. doi: 10.1093/carcin/bgq052. Epub 2010 Mar 10.
• [14] RNA-binding protein quaking, a critical regulator of colon epithelial differentiation and a suppressor of colon cancer.Gastroenterology. 2010 Jan;138(1):231-40.e1-5. doi: 10.1053/j.gastro.2009.08.001. Epub 2009 Aug 15.
• [15] The RNA-Binding Protein HuR Confers Oxaliplatin Resistance of Colorectal Cancer By Upregulating CDC6.Mol Cancer Ther. 2019 Jul;18(7):1243-1254. doi: 10.1158/1535-7163.MCT-18-0945. Epub 2019 May 7.
• [16] RNA-binding protein RBM20 represses splicing to orchestrate cardiac pre-mRNA processing.J Clin Invest. 2014 Aug;124(8):3419-30. doi: 10.1172/JCI74523. Epub 2014 Jun 24.
• [17] Identification of NOD2 as a novel target of RNA-binding protein HuR: evidence from NADPH oxidase-mediated HuR signaling in diabetic nephropathy.Free Radic Biol Med. 2015 Feb;79:217-27. doi: 10.1016/j.freeradbiomed.2014.12.013. Epub 2014 Dec 18.
• [18] A balancing act: RNA binding protein HuR/TTP axis in endometriosis patients.Sci Rep. 2017 Jul 19;7(1):5883. doi: 10.1038/s41598-017-06081-7.
• [19] Identification of clinical trait-related lncRNA and mRNA biomarkers with weighted gene co-expression network analysis as useful tool for personalized medicine in ovarian cancer.EPMA J. 2019 Jul 19;10(3):273-290. doi: 10.1007/s13167-019-00175-0. eCollection 2019 Sep.
• [20] The RNA-binding protein CUG-BP1 increases survivin expression in oesophageal cancer cells through enhanced mRNA stability.Biochem J. 2012 Aug 15;446(1):113-23. doi: 10.1042/BJ20120112.
• [21] Functional and dynamic polymerization of the ALS-linked protein TDP-43 antagonizes its pathologic aggregation.Nat Commun. 2017 Jun 29;8(1):45. doi: 10.1038/s41467-017-00062-0.
• [22] Hu antigen R (HuR) multimerization contributes to glioma disease progression.J Biol Chem. 2017 Oct 13;292(41):16999-17010. doi: 10.1074/jbc.M117.797878. Epub 2017 Aug 8.
• [23] Characterization of squamous cell carcinoma in an organotypic culture via subsurface non-linear optical molecular imaging.Exp Biol Med (Maywood). 2013 Nov 1;238(11):1233-41. doi: 10.1177/1535370213502628. Epub 2013 Oct 1.
• [24] Lin28b is involved in curcumin-reversed paclitaxel chemoresistance and associated with poor prognosis in hepatocellular carcinoma.J Cancer. 2019 Oct 15;10(24):6074-6087. doi: 10.7150/jca.33421. eCollection 2019.
• [25] The intellectual disability gene PQBP1 rescues Alzheimer's disease pathology.Mol Psychiatry. 2018 Oct;23(10):2090-2110. doi: 10.1038/s41380-018-0253-8. Epub 2018 Oct 3.
• [26] RBMY, a male germ cell-specific RNA-binding protein, activated in human liver cancers and transforms rodent fibroblasts.Oncogene. 2004 Jul 29;23(34):5815-22. doi: 10.1038/sj.onc.1207773.
• [27] Expression of the RNA-binding protein CRD-BP in brain and non-small cell lung tumors.Cancer Lett. 2004 Jun 25;209(2):245-50. doi: 10.1016/j.canlet.2003.12.015.
• [28] Multiple functions of HuR in urinary tumors.J Cancer Res Clin Oncol. 2019 Jan;145(1):11-18. doi: 10.1007/s00432-018-2778-2. Epub 2018 Oct 28.
• [29] Dysfunctional RNA-binding protein biology and neurodegeneration in experimental autoimmune encephalomyelitis in female mice.J Neurosci Res. 2020 Apr;98(4):704-717. doi: 10.1002/jnr.24554. Epub 2019 Nov 22.
• [30] The RNA-binding protein HuR stabilizes cytosolic phospholipase A2 mRNA under interleukin-1 treatment in non-small cell lung cancer A549 Cells.J Biol Chem. 2011 Oct 14;286(41):35499-35508. doi: 10.1074/jbc.M111.263582. Epub 2011 Aug 23.
• [31] SRRM2, a potential blood biomarker revealing high alternative splicing in Parkinson's disease.PLoS One. 2010 Feb 8;5(2):e9104. doi: 10.1371/journal.pone.0009104.
• [32] The RNA-binding protein FXR1 modulates prostate cancer progression by regulating FBXO4.Funct Integr Genomics. 2019 May;19(3):487-496. doi: 10.1007/s10142-019-00661-8. Epub 2019 Feb 11.
• [33] Repression of caspase-3 and RNA-binding protein HuR cleavage by cyclooxygenase-2 promotes drug resistance in oral squamous cell carcinoma.Oncogene. 2017 Jun 1;36(22):3137-3148. doi: 10.1038/onc.2016.451. Epub 2016 Dec 12.
• [34] The RNA-binding protein PCBP2 facilitates gastric carcinoma growth by targeting miR-34a.Biochem Biophys Res Commun. 2014 Jun 13;448(4):437-42. doi: 10.1016/j.bbrc.2014.04.124. Epub 2014 May 2.
• [35] HnRNP-L promotes prostate cancer progression by enhancing cell cycling and inhibiting apoptosis.Oncotarget. 2017 Mar 21;8(12):19342-19353. doi: 10.18632/oncotarget.14258.
• [36] Silencing of long noncoding RNA SRRM2-AS exerts suppressive effects on angiogenesis in nasopharyngeal carcinoma via activating MYLK-mediated cGMP-PKG signaling pathway.J Cell Physiol. 2020 Nov;235(11):7757-7768. doi: 10.1002/jcp.29382. Epub 2019 Nov 19.
• [37] Mammalian germ cells are determined after PGC colonization of the nascent gonad.Proc Natl Acad Sci U S A. 2019 Dec 17;116(51):25677-25687. doi: 10.1073/pnas.1910733116. Epub 2019 Nov 21.
• [38] Fragile X Syndrome: from molecular pathology to therapy.Neurosci Biobehav Rev. 2014 Oct;46 Pt 2:242-55. doi: 10.1016/j.neubiorev.2014.01.006. Epub 2014 Jan 22.
• [39] Identification of Upregulated HNRNPs Associated with Poor Prognosis in Pancreatic Cancer.Biomed Res Int. 2019 Jul 4;2019:5134050. doi: 10.1155/2019/5134050. eCollection 2019.
• [40] A germline mutation in SRRM2, a splicing factor gene, is implicated in papillary thyroid carcinoma predisposition.Sci Rep. 2015 Jul 2;5:10566. doi: 10.1038/srep10566.
• [41] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [42] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [43] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [44] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [45] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [46] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [48] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [49] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [50] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [51] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [52] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [53] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [54] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [55] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [56] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [57] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [58] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [59] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [60] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [61] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [62] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [63] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [64] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [65] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.