Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTOIX77)

• DOT Name: Intercellular adhesion molecule 1 (ICAM1)
• Synonyms: ICAM-1; Major group rhinovirus receptor; CD antigen CD54
• Gene Name: ICAM1
• UniProt ID: ICAM1_HUMAN
• PDB ID: 1D3E; 1D3I; 1D3L; 1IAM; 1IC1; 1MQ8; 1P53; 1Z7Z; 2OZ4; 3TCX; 5MZA; 6EIT; 6S8U; 7BG7
• Pfam ID: PF21146 ; PF03921 ; PF13895
• Sequence:
  MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
  ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
  LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
  GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
  GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
  TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
  TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
  AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
  IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
• Function: ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell.
• KEGG Pathway:
  NF-kappa B sig.ling pathway (hsa04064)
  Cell adhesion molecules (hsa04514)
  .tural killer cell mediated cytotoxicity (hsa04650)
  TNF sig.ling pathway (hsa04668)
  Leukocyte transendothelial migration (hsa04670)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  African trypanosomiasis (hsa05143)
  Malaria (hsa05144)
  Staphylococcus aureus infection (hsa05150)
  Influenza A (hsa05164)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Epstein-Barr virus infection (hsa05169)
  Rheumatoid arthritis (hsa05323)
  Viral myocarditis (hsa05416)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Integrin cell surface interactions (R-HSA-216083)
  Interleukin-10 signaling (R-HSA-6783783)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Interferon gamma signaling (R-HSA-877300)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Indomethacin	DMSC4A7	Approved	Intercellular adhesion molecule 1 (ICAM1) increases the Gastric disorder ADR of Indomethacin.	[80]
Thalidomide	DM70BU5	Approved	Intercellular adhesion molecule 1 (ICAM1) increases the response to substance of Thalidomide.	[81]
Allopurinol	DMLPAOB	Approved	Intercellular adhesion molecule 1 (ICAM1) increases the Reperfusion injury ADR of Allopurinol.	[80]
Ergonovine	DM0VEC1	Approved	Intercellular adhesion molecule 1 (ICAM1) increases the Liver injury ADR of Ergonovine.	[80]
LXA4	DMGSVL0	Investigative	Intercellular adhesion molecule 1 (ICAM1) affects the response to substance of LXA4.	[82]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Intercellular adhesion molecule 1 (ICAM1).	[1]

99 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Intercellular adhesion molecule 1 (ICAM1).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[16]
Marinol	DM70IK5	Approved	Marinol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[17]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[18]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Intercellular adhesion molecule 1 (ICAM1).	[19]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[20]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[21]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[22]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[17]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[12]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[23]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[24]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[25]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[26]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[27]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Intercellular adhesion molecule 1 (ICAM1).	[14]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[13]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[28]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[29]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[30]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[31]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[26]
Vinblastine	DM5TVS3	Approved	Vinblastine decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[27]
Ibuprofen	DM8VCBE	Approved	Ibuprofen decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[32]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[33]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[34]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[35]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[36]
Chenodiol	DMQ8JIK	Approved	Chenodiol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[37]
Deoxycholic acid	DM3GYAL	Approved	Deoxycholic acid increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[37]
Gentamicin	DMKINJO	Approved	Gentamicin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[38]
Atazanavir	DMSYRBX	Approved	Atazanavir increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[36]
Cimetidine	DMH61ZB	Approved	Cimetidine decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[39]
Fructose	DM43AN2	Approved	Fructose increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[40]
Sulfasalazine	DMICA9H	Approved	Sulfasalazine decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[41]
Sodium chloride	DMM3950	Approved	Sodium chloride increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[13]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[42]
Norepinephrine	DMOUC09	Approved	Norepinephrine increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[43]
Erythromycin	DM4K7GQ	Approved	Erythromycin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[44]
Salicyclic acid	DM2F8XZ	Approved	Salicyclic acid affects the expression of Intercellular adhesion molecule 1 (ICAM1).	[45]
Tibolone	DM78XFG	Approved	Tibolone decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[46]
Fexofenadine	DM17ONX	Approved	Fexofenadine decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[47]
Lopinavir	DMITQS0	Approved	Lopinavir increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[36]
Tecfidera	DM2OVDT	Approved	Tecfidera decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[48]
Pimecrolimus	DMZLGRB	Approved	Pimecrolimus decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[49]
Dicloxacillin	DM8EU0Z	Approved	Dicloxacillin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[44]
Etoricoxib	DM6A4NW	Approved	Etoricoxib decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[32]
Ceruletide	DM2WE5K	Approved	Ceruletide increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[50]
Mizolastine	DM1FDN8	Approved	Mizolastine decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[51]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[20]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[52]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[53]
Triptolide	DMCMDVR	Phase 3	Triptolide decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[32]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[54]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[55]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[56]
URSOLIC ACID	DM4SOAW	Phase 2	URSOLIC ACID decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[57]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[58]
Tetrandrine	DMAOJBX	Phase 1	Tetrandrine increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[59]
Ribavirin	DMEYLH9	Phase 1 Trial	Ribavirin decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[60]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[61]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[62]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[63]
Ciglitazone	DMAPO0T	Preclinical	Ciglitazone decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[23]
Acteoside	DM0YHKB	Terminated	Acteoside decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[64]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[65]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[66]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[67]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[68]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[69]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[70]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[71]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[72]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[73]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[62]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[62]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[74]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[75]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate decreases the expression of Intercellular adhesion molecule 1 (ICAM1).	[76]
Cordycepin	DM72Y01	Investigative	Cordycepin affects the expression of Intercellular adhesion molecule 1 (ICAM1).	[77]
Rutin	DMEHRAJ	Investigative	Rutin increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[78]
CATECHIN	DMY38SB	Investigative	CATECHIN increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[78]
Linalool	DMGZQ5P	Investigative	Linalool increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[79]
	DM9CEI5		increases the expression of Intercellular adhesion molecule 1 (ICAM1).	[37]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Characterisation of cisplatin-induced transcriptomics responses in primary mouse hepatocytes, HepG2 cells and mouse embryonic stem cells shows conservation of regulating transcription factor networks. Mutagenesis. 2014 Jan;29(1):17-26.
• [8] Effect of ovarian steroids on gene expression profile in human uterine microvascular endothelial cells. Fertil Steril. 2009 Aug;92(2):709-21.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Increases in oxidized low-density lipoprotein and other inflammatory and adhesion molecules with a concomitant decrease in high-density lipoprotein in the individuals exposed to arsenic in Bangladesh. Toxicol Sci. 2013 Sep;135(1):17-25. doi: 10.1093/toxsci/kft130. Epub 2013 Jun 12.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Synergistic antiproliferative effect of arsenic trioxide combined with bortezomib in HL60 cell line and primary blasts from patients affected by myeloproliferative disorders. Cancer Genet Cytogenet. 2010 Jun;199(2):110-20. doi: 10.1016/j.cancergencyto.2010.02.010.
• [13] Cytokine mRNA profiles in cultured human skin component cells exposed to various chemicals: a simulation model of epicutaneous stimuli induced by skin barrier perturbation in comparison with that due to exposure to haptens or irritant. J Dermatol Sci. 2001 Jun;26(2):85-93. doi: 10.1016/s0923-1811(00)00165-1.
• [14] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [15] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [16] Functional up-regulation of human leukocyte antigen class I antigens expression by 5-aza-2'-deoxycytidine in cutaneous melanoma: immunotherapeutic implications. Clin Cancer Res. 2007 Jun 1;13(11):3333-8. doi: 10.1158/1078-0432.CCR-06-3091.
• [17] Cannabidiol inhibits lung cancer cell invasion and metastasis via intercellular adhesion molecule-1. FASEB J. 2012 Apr;26(4):1535-48. doi: 10.1096/fj.11-198184. Epub 2011 Dec 23.
• [18] Defective gammadelta T-cell function and granzyme B gene polymorphism in a cohort of newly diagnosed breast cancer patients. Exp Hematol. 2009 Jul;37(7):838-48. doi: 10.1016/j.exphem.2009.04.003. Epub 2009 May 14.
• [19] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [20] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [21] NF-kappaB activation for constitutive expression of VCAM-1 and ICAM-1 on B lymphocytes and plasma cells. Biochem Biophys Res Commun. 2001 Dec 14;289(4):851-6. doi: 10.1006/bbrc.2001.6067.
• [22] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [23] Peroxisome proliferator-activated receptor-gamma agonists inhibit respiratory syncytial virus-induced expression of intercellular adhesion molecule-1 in human lung epithelial cells. Immunology. 2007 May;121(1):71-81. doi: 10.1111/j.1365-2567.2006.02539.x.
• [24] PPARgamma inhibits NF-kappaB-dependent transcriptional activation in skeletal muscle. Am J Physiol Endocrinol Metab. 2009 Jul;297(1):E174-83. doi: 10.1152/ajpendo.90632.2008. Epub 2009 May 5.
• [25] An in vitro model of human acute ethanol exposure that incorporates CXCR3- and CXCR4-dependent recruitment of immune cells. Toxicol Sci. 2013 Mar;132(1):131-41.
• [26] The proapoptotic effects of sulindac, sulindac sulfone and indomethacin are mediated by nucleolar translocation of the RelA(p65) subunit of NF-kappaB. Oncogene. 2008 Apr 17;27(18):2648-55. doi: 10.1038/sj.onc.1210891. Epub 2007 Dec 3.
• [27] Exposure to paclitaxel or vinblastine down-regulates CD11a and CD54 expression by P815 mastocytoma cells and renders the tumor cells resistant to killing by nonspecific cytotoxic T lymphocytes induced with anti-CD3 antibody. Cancer Immunol Immunother. 2003 Mar;52(3):185-93. doi: 10.1007/s00262-002-0357-4. Epub 2003 Feb 7.
• [28] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [29] Simvastatin reduces the expression of adhesion molecules in circulating monocytes from hypercholesterolemic patients. Arterioscler Thromb Vasc Biol. 2003 Mar 1;23(3):397-403. doi: 10.1161/01.ATV.0000059384.34874.F0. Epub 2003 Jan 30.
• [30] Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
• [31] The nitrogen mustard melphalan activates mitogen-activated phosphorylated kinases (MAPK), nuclear factor-kappaB and inflammatory response in lung epithelial cells. J Appl Toxicol. 2005 Jul-Aug;25(4):328-37. doi: 10.1002/jat.1070.
• [32] Upregulation of ICAM-1 expression in bronchial epithelial cells by airway secretions in bronchiectasis. Respir Med. 2008 Feb;102(2):287-98. doi: 10.1016/j.rmed.2007.08.013. Epub 2007 Oct 10.
• [33] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [34] Crucial role of Toll-like receptors in the zinc/nickel-induced inflammatory response in vascular endothelial cells. Toxicol Appl Pharmacol. 2013 Dec 15;273(3):492-9. doi: 10.1016/j.taap.2013.09.014. Epub 2013 Sep 29.
• [35] Effects of Imatinib Mesylate (Gleevec) on human islet NF-kappaB activation and chemokine production in vitro. PLoS One. 2011;6(9):e24831. doi: 10.1371/journal.pone.0024831. Epub 2011 Sep 14.
• [36] Heme oxygenase-1-derived bilirubin counteracts HIV protease inhibitor-mediated endothelial cell dysfunction. Free Radic Biol Med. 2016 May;94:218-29. doi: 10.1016/j.freeradbiomed.2016.03.003. Epub 2016 Mar 8.
• [37] Bile acids induce adhesion molecule expression in endothelial cells through activation of reactive oxygen species, NF-kappaB, and p38. Am J Physiol Heart Circ Physiol. 2006 Aug;291(2):H741-7. doi: 10.1152/ajpheart.01182.2005. Epub 2006 Mar 31.
• [38] In vitro evaluation of biomarkers of nephrotoxicity through gene expression using gentamicin. J Biochem Mol Toxicol. 2018 Sep;32(9):e22189. doi: 10.1002/jbt.22189. Epub 2018 Jul 10.
• [39] Effects of histamine 2 receptor antagonists on endothelial-neutrophil adhesion and surface expression of endothelial adhesion molecules induced by high glucose levels. J Diabetes Complications. 2007 Jan-Feb;21(1):50-5. doi: 10.1016/j.jdiacomp.2006.02.002.
• [40] Fructose induces the inflammatory molecule ICAM-1 in endothelial cells. J Am Soc Nephrol. 2008 Sep;19(9):1712-20.
• [41] [The effects of anti-inflammatory on activation of nuclear factor-kappaB and expression of cell adhesion molecules in patients with ulcerative colitis]. Sheng Wu Yi Xue Gong Cheng Xue Za Zhi. 2004 Oct;21(5):732-6.
• [42] Effects of niacin on cell adhesion and early atherogenesis: biochemical and functional findings in endothelial cells. Basic Clin Pharmacol Toxicol. 2009 Mar;104(3):206-10. doi: 10.1111/j.1742-7843.2008.00364.x. Epub 2009 Jan 21.
• [43] Targeting activation of specific NF-B subunits prevents stress-dependent atherothrombotic gene expression. Mol Med. 2012 Dec 20;18(1):1375-86. doi: 10.2119/molmed.2012.00282.
• [44] Dicloxacillin and erythromycin at high concentrations increase ICAM-1 expression by endothelial cells: a possible factor in the pathogenesis of infusion phlebitis. J Antimicrob Chemother. 2004 Feb;53(2):174-9. doi: 10.1093/jac/dkh056. Epub 2004 Jan 16.
• [45] Some non-sensitizers upregulate CD54 expression by activation of the NLRP3 inflammasome in THP-1 cells. J Toxicol Sci. 2019;44(3):213-224. doi: 10.2131/jts.44.213.
• [46] Effects of hormone treatment on hemostasis variables. Climacteric. 2007 Oct;10 Suppl 2:32-7. doi: 10.1080/13697130701598548.
• [47] The effect of fexofenadine on expression of intercellular adhesion molecule 1 and induction of apoptosis on peripheral eosinophils. Allergy Asthma Proc. 2005 Jul-Aug;26(4):292-8.
• [48] Dimethyl Fumarate Inhibits the Nuclear Factor B Pathway in Breast Cancer Cells by Covalent Modification of p65 Protein. J Biol Chem. 2016 Feb 12;291(7):3639-47. doi: 10.1074/jbc.M115.679704. Epub 2015 Dec 18.
• [49] Pimecrolimus inhibits up-regulation of OX40 and synthesis of inflammatory cytokines upon secondary T cell activation by allogeneic dendritic cells. Clin Exp Immunol. 2002 Oct;130(1):85-92. doi: 10.1046/j.1365-2249.2002.01962.x.
• [50] Acinar cell-specific knockout of the PTHrP gene decreases the proinflammatory and profibrotic responses in pancreatitis. Am J Physiol Gastrointest Liver Physiol. 2014 Sep 1;307(5):G533-49. doi: 10.1152/ajpgi.00428.2013. Epub 2014 Jul 17.
• [51] Antiallergic effects of H1-receptor antagonists. Allergy. 2000;55 Suppl 64:17-27. doi: 10.1034/j.1398-9995.2000.00803.x.
• [52] Antioxidant and signal modulation properties of plant polyphenols in controlling vascular inflammation. Eur J Pharmacol. 2011 May 11;658(2-3):248-56.
• [53] Markers of inflammation, thrombosis and endothelial activation correlate with carotid IMT regression in stable coronary disease after atorvastatin treatment. Nutr Metab Cardiovasc Dis. 2009 Sep;19(7):481-90. doi: 10.1016/j.numecd.2008.10.003. Epub 2009 Jan 26.
• [54] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [55] Preliminary discovery of novel markers for human cell line activation test (h-CLAT). Toxicol In Vitro. 2021 Aug;74:105154. doi: 10.1016/j.tiv.2021.105154. Epub 2021 Mar 25.
• [56] Quercetin inhibits inducible ICAM-1 expression in human endothelial cells through the JNK pathway. Am J Physiol. 1999 Sep;277(3):C403-11. doi: 10.1152/ajpcell.1999.277.3.C403.
• [57] Inhibition of cell proliferation, invasion and migration by ursolic acid in human lung cancer cell lines. Toxicol In Vitro. 2011 Oct;25(7):1274-80. doi: 10.1016/j.tiv.2011.04.014. Epub 2011 Apr 20.
• [58] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [59] Differentiation induction of human breast cancer cells by arsenite in combination with tetrandrine. Am J Transl Res. 2019 Dec 15;11(12):7310-7323. eCollection 2019.
• [60] Correlation of sICAM-1 and sVCAM-1 level with biochemical, histological and viral findings in chronic hepatitis C after interferon-alpha + ribavirin therapy. Rom J Gastroenterol. 2003 Jun;12(2):91-5.
• [61] Hepatic co-cultures in vitro reveal suitable to detect Nrf2-mediated oxidative stress responses on the bladder carcinogen o-anisidine. Toxicol In Vitro. 2017 Apr;40:153-160.
• [62] The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
• [63] Celecoxib increases lung cancer cell lysis by lymphokine-activated killer cells via upregulation of ICAM-1. Oncotarget. 2015 Nov 17;6(36):39342-56. doi: 10.18632/oncotarget.5745.
• [64] Bisphenol-A impairs cellular function and alters DNA methylation of stress pathway genes in first trimester trophoblast cells. Reprod Toxicol. 2018 Dec;82:72-79.
• [65] Effect of formaldehyde on the expression of adhesion molecules in nasal microvascular endothelial cells: the role of formaldehyde in the pathogenesis of sick building syndrome. Clin Exp Allergy. 2002 Feb;32(2):287-95. doi: 10.1046/j.1365-2222.2002.01301.x.
• [66] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [67] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [68] SODs are involved in the regulation of ICAM-1 expression in human melanoma and endothelial cells. Cell Mol Biol (Noisy-le-grand). 1999 Nov;45(7):1053-63.
• [69] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [70] Geraniol improves endothelial function by inhibiting NOX-2 derived oxidative stress in high fat diet fed mice. Biochem Biophys Res Commun. 2016 May 20;474(1):182-187. doi: 10.1016/j.bbrc.2016.04.097. Epub 2016 Apr 21.
• [71] Intermittent high glucose enhances ICAM-1, VCAM-1, E-selectin and interleukin-6 expression in human umbilical endothelial cells in culture: the role of poly(ADP-ribose) polymerase. J Thromb Haemost. 2004 Aug;2(8):1453-9. doi: 10.1111/j.1538-7836.2004.00835.x.
• [72] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [73] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [74] Low-dose tributyltin triggers human chondrocyte senescence and mouse articular cartilage aging. Arch Toxicol. 2023 Feb;97(2):547-559. doi: 10.1007/s00204-022-03407-x. Epub 2022 Nov 1.
• [75] Effect of cytokines on ICAM-1 and ZO-1 expression on human airway epithelial cells. Cell Biol Int. 2005 Sep;29(9):768-77. doi: 10.1016/j.cellbi.2005.05.002.
• [76] Integration of data from the in vitro long-term exposure study on human endothelial cells and the in silico analysis: A case of dibutyl phthalate-induced vascular dysfunction. Toxicol Lett. 2022 Mar 1;356:64-74. doi: 10.1016/j.toxlet.2021.12.006. Epub 2021 Dec 10.
• [77] Effect of cordycepin on interleukin-10 production of human peripheral blood mononuclear cells. Eur J Pharmacol. 2002 Oct 25;453(2-3):309-17. doi: 10.1016/s0014-2999(02)02359-2.
• [78] Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
• [79] Editor's highlight: fragrance allergens linalool and limonene allylic hydroperoxides in skin allergy: Mechanisms of action focusing on transcription factor Nrf2. Toxicol Sci. 2018 Jan 1;161(1):139-148.
• [80] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [81] Genetic factors underlying the risk of thalidomide-related neuropathy in patients with multiple myeloma. J Clin Oncol. 2011 Mar 1;29(7):797-804. doi: 10.1200/JCO.2010.28.0792. Epub 2011 Jan 18.
• [82] Mechanisms for lipoxin A4-induced neutrophil-dependent cytotoxicity for human endothelial cells. J Lab Clin Med. 1995 Jul;126(1):36-43.