Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVVI3UI)

• DOT Name: HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1)
• Synonyms: MHC class II antigen DQB1
• Gene Name: HLA-DQB1
• Related Disease:
  Dilated cardiomyopathy 1A
  Myasthenia gravis
  Tuberculosis
  Achalasia
  Allergy
  Alopecia
  Angioedema
  Cervical cancer
  Cervical carcinoma
  Cervical Intraepithelial neoplasia
  Crohn disease
  Epstein barr virus infection
  Graves disease
  Hepatitis B virus infection
  Idiopathic achalasia
  IgA nephropathy
  Lymphoma
  Major depressive disorder
  Nephrotic syndrome
  Oropharyngeal cancer
  Oropharyngeal carcinoma
  Pharynx neoplasm
  Pneumocystis pneumonia
  Sclerosing cholangitis
  Systemic sclerosis
  Type IV hypersensitivity disease
  Urticaria
  Uveitis
  Bullous pemphigoid
  Sarcoidosis
  Sleep disorder
  Follicular lymphoma
  Hepatocellular carcinoma
  Melanoma
  Moyamoya disease
  Neoplasm
  Neoplasm of oropharynx
  Non-insulin dependent diabetes
  Pemphigus vulgaris
  Rheumatoid arthritis
  Systemic lupus erythematosus
• UniProt ID: DQB1_HUMAN
• PDB ID: 1JK8; 1S9V; 1UVQ; 2NNA; 4GG6; 4OZF; 4OZG; 4OZH; 4OZI
• Pfam ID: PF07654 ; PF00969
• Sequence:
  MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVT
  RYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELR
  TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLI
  RNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
  GLIFLGLGLIIHHRSQKGLLH
• Function: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
• KEGG Pathway:
  Phagosome (hsa04145)
  Cell adhesion molecules (hsa04514)
  Antigen processing and presentation (hsa04612)
  Hematopoietic cell lineage (hsa04640)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  Intesti.l immune network for IgA production (hsa04672)
  Type I diabetes mellitus (hsa04940)
  Leishmaniasis (hsa05140)
  Toxoplasmosis (hsa05145)
  Staphylococcus aureus infection (hsa05150)
  Tuberculosis (hsa05152)
  Influenza A (hsa05164)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Herpes simplex virus 1 infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
  Asthma (hsa05310)
  Autoimmune thyroid disease (hsa05320)
  Inflammatory bowel disease (hsa05321)
  Systemic lupus erythematosus (hsa05322)
  Rheumatoid arthritis (hsa05323)
  Allograft rejection (hsa05330)
  Graft-versus-host disease (hsa05332)
  Viral myocarditis (hsa05416)
• Reactome Pathway:
  Phosphorylation of CD3 and TCR zeta chains (R-HSA-202427)
  Translocation of ZAP-70 to Immunological synapse (R-HSA-202430)
  Generation of second messenger molecules (R-HSA-202433)
  MHC class II antigen presentation (R-HSA-2132295)
  PD-1 signaling (R-HSA-389948)
  Interferon gamma signaling (R-HSA-877300)
  Downstream TCR signaling (R-HSA-202424)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Dilated cardiomyopathy 1A	DIS0RK9Z	Definitive	Genetic Variation	[1]
Myasthenia gravis	DISELRCI	Definitive	Genetic Variation	[2]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[3]
Achalasia	DISK845N	Strong	Genetic Variation	[4]
Allergy	DIS48ZAP	Strong	Biomarker	[5]
Alopecia	DIS37HU4	Strong	Genetic Variation	[6]
Angioedema	DIS90QDN	Strong	Biomarker	[7]
Cervical cancer	DISFSHPF	Strong	Genetic Variation	[8]
Cervical carcinoma	DIST4S00	Strong	Genetic Variation	[8]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Genetic Variation	[9]
Crohn disease	DIS2C5Q8	Strong	Genetic Variation	[10]
Epstein barr virus infection	DISOO0WT	Strong	Genetic Variation	[11]
Graves disease	DISU4KOQ	Strong	Biomarker	[12]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[13]
Idiopathic achalasia	DISBZNRO	Strong	SusceptibilityMutation	[14]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[15]
Lymphoma	DISN6V4S	Strong	Altered Expression	[16]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[17]
Nephrotic syndrome	DISSPSC2	Strong	Genetic Variation	[18]
Oropharyngeal cancer	DISDAMTJ	Strong	Genetic Variation	[19]
Oropharyngeal carcinoma	DIS7K3AI	Strong	Genetic Variation	[19]
Pharynx neoplasm	DISQCA3F	Strong	Genetic Variation	[19]
Pneumocystis pneumonia	DISFSOM3	Strong	Biomarker	[20]
Sclerosing cholangitis	DIS7GZNB	Strong	Genetic Variation	[21]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[22]
Type IV hypersensitivity disease	DISPBWVK	Strong	Biomarker	[23]
Urticaria	DIS9WQAI	Strong	Biomarker	[24]
Uveitis	DISV0RYS	Strong	Genetic Variation	[25]
Bullous pemphigoid	DISOJLKV	moderate	Genetic Variation	[26]
Sarcoidosis	DISE5B8Z	moderate	Genetic Variation	[27]
Sleep disorder	DIS3JP1U	moderate	Genetic Variation	[28]
Follicular lymphoma	DISVEUR6	Limited	Genetic Variation	[29]
Hepatocellular carcinoma	DIS0J828	Limited	Genetic Variation	[30]
Melanoma	DIS1RRCY	Limited	Biomarker	[31]
Moyamoya disease	DISO62CA	Limited	Genetic Variation	[32]
Neoplasm	DISZKGEW	Limited	Altered Expression	[33]
Neoplasm of oropharynx	DIS6YM4S	Limited	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[34]
Pemphigus vulgaris	DISENR62	Limited	Genetic Variation	[35]
Rheumatoid arthritis	DISTSB4J	Limited	Posttranslational Modification	[36]
Systemic lupus erythematosus	DISI1SZ7	Limited	Genetic Variation	[37]

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1) decreases the response to substance of Arsenic.	[53]
Aspirin	DM672AH	Approved	HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1) increases the Urticaria ADR of Aspirin.	[7]
Lapatinib	DM3BH1Y	Approved	HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1) increases the Hepatotoxicty ADR of Lapatinib.	[55]
Allopurinol	DMLPAOB	Approved	HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1) increases the Toxic epidermal necrolysis ADR of Allopurinol.	[56]
Lumiracoxib	DM1S4AG	Approved	HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1) affects the response to substance of Lumiracoxib.	[57]
Ticlopidine	DMO946V	Approved	HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1) increases the Liver injury ADR of Ticlopidine.	[58]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[41]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Selenium	DM25CGV	Approved	Selenium increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[43]
Dexamethasone	DMMWZET	Approved	Dexamethasone affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[44]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[45]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[46]
Simvastatin	DM30SGU	Approved	Simvastatin affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Rifampicin	DM5DSFZ	Approved	Rifampicin affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Nifedipine	DMSVOZT	Approved	Nifedipine affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Pentamidine	DMHZJCG	Approved	Pentamidine affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Ketoprofen	DMRKXPT	Approved	Ketoprofen affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Amoxicillin	DMUYNEI	Approved	Amoxicillin affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Fenoprofen	DML5VQ0	Approved	Fenoprofen affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Oxaprozin	DM9UB0P	Approved	Oxaprozin affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Metronidazole	DMTIVEN	Approved	Metronidazole affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Tolmetin	DMWUIJE	Approved	Tolmetin affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
Cefuroxime	DMSIMD8	Approved	Cefuroxime affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[42]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[47]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[48]
Rigosertib	DMOSTXF	Phase 3	Rigosertib affects the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[49]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[50]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of HLA class II histocompatibility antigen, DQ beta 1 chain (HLA-DQB1).	[52]

References

• [1] The HLA class II allele DQB1 0309 is associated with dilated cardiomyopathy.Gene. 2013 Dec 1;531(2):180-3. doi: 10.1016/j.gene.2013.09.022. Epub 2013 Sep 16.
• [2] Thymomatous myasthenia gravis: novel association with HLA DQB1*05:01 and strengthened evidence of high clinical and serological severity.J Neurol. 2019 Apr;266(4):982-989. doi: 10.1007/s00415-019-09225-z. Epub 2019 Feb 11.
• [3] Association of human leukocyte antigens-DQB2/DPA1/DPB1 polymorphism and pulmonary tuberculosis in the Chinese Uygur population.Mol Genet Genomic Med. 2019 Mar;7(3):e544. doi: 10.1002/mgg3.544. Epub 2019 Jan 1.
• [4] First genotype-phenotype study reveals HLA-DQ1 insertion heterogeneity in high-resolution manometry achalasia subtypes.United European Gastroenterol J. 2019 Feb;7(1):45-51. doi: 10.1177/2050640618804717. Epub 2018 Oct 3.
• [5] [Analysis of a genetic factor of metal allergy--polymorphism of HLA-DR, -DQ gene].Kokubyo Gakkai Zasshi. 1996 Mar;63(1):53-69. doi: 10.5357/koubyou.63.53.
• [6] Genetic association of HLA-DQB1 and HLA-DRB1 polymorphisms with alopecia areata in the Italian population.Br J Dermatol. 2011 Oct;165(4):823-7. doi: 10.1111/j.1365-2133.2011.10466.x. Epub 2011 Sep 15.
• [7] The human leucocyte antigen-DRB1*1302-DQB1*0609-DPB1*0201 haplotype may be a strong genetic marker for aspirin-induced urticaria. Clin Exp Allergy. 2005 Mar;35(3):339-44. doi: 10.1111/j.1365-2222.2004.02197.x.
• [8] Protective association of HLA-DRB1*13:02, HLA-DRB1*04:06, and HLA-DQB1*06:04 alleles with cervical cancer in a Korean population.Hum Immunol. 2019 Feb;80(2):107-111. doi: 10.1016/j.humimm.2018.10.013. Epub 2018 Oct 21.
• [9] Persistent HPV16/18 infection in Indian women with the A-allele (rs6457617) of HLA-DQB1 and T-allele (rs16944) of IL-1 -511 is associated with development of cervical carcinoma.Cancer Immunol Immunother. 2015 Jul;64(7):843-51. doi: 10.1007/s00262-015-1693-5. Epub 2015 Apr 17.
• [10] A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.Gastroenterology. 2013 Apr;144(4):781-8. doi: 10.1053/j.gastro.2012.12.021. Epub 2012 Dec 22.
• [11] A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).PLoS Genet. 2013;9(1):e1003147. doi: 10.1371/journal.pgen.1003147. Epub 2013 Jan 10.
• [12] Analysis of HLA class II genes in Hashimoto's thyroiditis reveals differences compared to Graves' disease.Genes Immun. 2008 Jun;9(4):358-63. doi: 10.1038/gene.2008.26. Epub 2008 May 1.
• [13] Association between HLA class II alleles and hepatitis B virus infection in Transylvania, Romania.Immunol Invest. 2018 Oct;47(7):735-744. doi: 10.1080/08820139.2018.1489832. Epub 2018 Jul 6.
• [14] Common variants in the HLA-DQ region confer susceptibility to idiopathic achalasia.Nat Genet. 2014 Aug;46(8):901-4. doi: 10.1038/ng.3029. Epub 2014 Jul 6.
• [15] DQB1*060101 may contribute to susceptibility to immunoglobulin A nephropathy in southern Han Chinese.Front Med. 2016 Dec;10(4):507-516. doi: 10.1007/s11684-016-0475-6. Epub 2016 Dec 23.
• [16] HLA Polymorphism in Algerian Children With Lymphomas.J Pediatr Hematol Oncol. 2015 Nov;37(8):e458-61. doi: 10.1097/MPH.0000000000000419.
• [17] Shared genetics of asthma and mental health disorders: a large-scale genome-wide cross-trait analysis.Eur Respir J. 2019 Dec 19;54(6):1901507. doi: 10.1183/13993003.01507-2019. Print 2019 Dec.
• [18] Genetic Identification of Two Novel Loci Associated with Steroid-Sensitive Nephrotic Syndrome.J Am Soc Nephrol. 2019 Aug;30(8):1375-1384. doi: 10.1681/ASN.2018101054. Epub 2019 Jul 1.
• [19] Genome-wide association analyses identify new susceptibility loci for oral cavity and pharyngeal cancer.Nat Genet. 2016 Dec;48(12):1544-1550. doi: 10.1038/ng.3685. Epub 2016 Oct 17.
• [20] Microarray studies on effects of Pneumocystis carinii infection on global gene expression in alveolar macrophages.BMC Microbiol. 2010 Apr 8;10:103. doi: 10.1186/1471-2180-10-103.
• [21] Genetic association analysis identifies variants associated with disease progression in primary sclerosing cholangitis.Gut. 2018 Aug;67(8):1517-1524. doi: 10.1136/gutjnl-2016-313598. Epub 2017 Aug 4.
• [22] Human Leukocyte Antigens-B and -C Loci Associated with Posner-Schlossman Syndrome in a Southern Chinese Population.PLoS One. 2015 Jul 10;10(7):e0132179. doi: 10.1371/journal.pone.0132179. eCollection 2015.
• [23] Two-domain MHC class II molecules form stable complexes with myelin basic protein 69-89 peptide that detect and inhibit rat encephalitogenic T cells and treat experimental autoimmune encephalomyelitis.J Immunol. 1998 Dec 1;161(11):5987-96.
• [24] Genetic markers for differentiating aspirin-hypersensitivity.Yonsei Med J. 2006 Feb 28;47(1):15-21. doi: 10.3349/ymj.2006.47.1.15.
• [25] Human leucocyte antigen DQ alpha heterodimers and human leucocyte antigen DR alleles in tubulointerstitial nephritis and uveitis syndrome.Nephrology (Carlton). 2008 Dec;13(8):755-7. doi: 10.1111/j.1440-1797.2008.00984.x.
• [26] Gliptin-associated Bullous Pemphigoid and the Expression of Dipeptidyl Peptidase-4/CD26 in Bullous Pemphigoid.Acta Derm Venereol. 2019 May 1;99(6):602-609. doi: 10.2340/00015555-3166.
• [27] Genome-wide association study of African and European Americans implicates multiple shared and ethnic specific loci in sarcoidosis susceptibility.PLoS One. 2012;7(8):e43907. doi: 10.1371/journal.pone.0043907. Epub 2012 Aug 27.
• [28] Prevalence of narcolepsy in King County, Washington, USA.Sleep Med. 2009 Apr;10(4):422-6. doi: 10.1016/j.sleep.2008.05.009. Epub 2008 Nov 13.
• [29] Follicular lymphoma-protective HLA class II variants correlate with increased HLA-DQB1 protein expression.Genes Immun. 2014 Mar;15(2):133-6. doi: 10.1038/gene.2013.64. Epub 2013 Dec 5.
• [30] Human leukocyte antigen variants and risk of hepatocellular carcinoma modified by hepatitis C virus genotypes: A genome-wide association study.Hepatology. 2018 Feb;67(2):651-661. doi: 10.1002/hep.29531. Epub 2018 Jan 1.
• [31] HLA class I and class II frequencies in patients with cutaneous malignant melanoma from southeastern Spain: the role of HLA-C in disease prognosis.Immunogenetics. 2006 Jan;57(12):926-33. doi: 10.1007/s00251-005-0065-2. Epub 2005 Dec 20.
• [32] Identification of HLA-DRB1*04:10 allele as risk allele for Japanese moyamoya disease and its association with autoimmune thyroid disease: A case-control study.PLoS One. 2019 Aug 14;14(8):e0220858. doi: 10.1371/journal.pone.0220858. eCollection 2019.
• [33] HLA-DQB1 expression on tumor cells is a novel favorable prognostic factor for relapse in early-stage lung adenocarcinoma.Cancer Manag Res. 2019 Apr 1;11:2605-2616. doi: 10.2147/CMAR.S197855. eCollection 2019.
• [34] Genome-wide association analyses identify 143 risk variants and putative regulatory mechanisms for type 2 diabetes.Nat Commun. 2018 Jul 27;9(1):2941. doi: 10.1038/s41467-018-04951-w.
• [35] Investigation of the predisposing factor of pemphigus and its clinical subtype through a genome-wide association and next generation sequence analysis.J Eur Acad Dermatol Venereol. 2019 Feb;33(2):410-415. doi: 10.1111/jdv.15227. Epub 2018 Sep 19.
• [36] Genome-wide DNA methylation patterns in CD4+ T cells from Chinese Han patients with rheumatoid arthritis. Mod Rheumatol. 2017 May;27(3):441-447.
• [37] Amino acid signatures of HLA Class-I and II molecules are strongly associated with SLE susceptibility and autoantibody production in Eastern Asians.PLoS Genet. 2019 Apr 25;15(4):e1008092. doi: 10.1371/journal.pgen.1008092. eCollection 2019 Apr.
• [38] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [39] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [40] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [41] Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
• [42] Systems pharmacological analysis of drugs inducing stevens-johnson syndrome and toxic epidermal necrolysis. Chem Res Toxicol. 2015 May 18;28(5):927-34. doi: 10.1021/tx5005248. Epub 2015 Apr 3.
• [43] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [44] Glucocorticoid regulation of human eosinophil gene expression. J Steroid Biochem Mol Biol. 2003 Mar;84(4):441-52. doi: 10.1016/s0960-0760(03)00065-7.
• [45] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [46] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [47] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [48] Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
• [49] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [50] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [51] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [52] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [53] Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility. Toxicol Appl Pharmacol. 2008 Jan 15;226(2):199-205. doi: 10.1016/j.taap.2007.09.004. Epub 2007 Sep 15.
• [54] The human leucocyte antigen-DRB1*1302-DQB1*0609-DPB1*0201 haplotype may be a strong genetic marker for aspirin-induced urticaria. Clin Exp Allergy. 2005 Mar;35(3):339-44. doi: 10.1111/j.1365-2222.2004.02197.x.
• [55] HLA-DQA1*02:01 is a major risk factor for lapatinib-induced hepatotoxicity in women with advanced breast cancer. J Clin Oncol. 2011 Feb 20;29(6):667-73. doi: 10.1200/JCO.2010.31.3197. Epub 2011 Jan 18.
• [56] A study of HLA class I and class II 4-digit allele level in Stevens-Johnson syndrome and toxic epidermal necrolysis. Int J Immunogenet. 2011 Aug;38(4):303-9. doi: 10.1111/j.1744-313X.2011.01011.x. Epub 2011 May 4.
• [57] A genome-wide study identifies HLA alleles associated with lumiracoxib-related liver injury. Nat Genet. 2010 Aug;42(8):711-4. doi: 10.1038/ng.632. Epub 2010 Jul 18.
• [58] Ticlopidine-induced hepatotoxicity is associated with specific human leukocyte antigen genomic subtypes in Japanese patients: a preliminary case-control study. Pharmacogenomics J. 2008 Feb;8(1):29-33. doi: 10.1038/sj.tpj.6500442. Epub 2007 Mar 6.