Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX94PD0)

• DOT Name: Nuclear factor 1 B-type (NFIB)
• Synonyms: NF1-B; Nuclear factor 1/B; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/B; NF-I/B; NFI-B; TGGCA-binding protein
• Gene Name: NFIB
• Related Disease:
  Osteosarcoma
  Abdominal aortic aneurysm
  Adenocarcinoma
  Adenoma
  Adult glioblastoma
  Advanced cancer
  Amyloidosis
  Astrocytoma
  Autism spectrum disorder
  Benign prostatic hyperplasia
  Bone giant cell tumor
  Breast cancer
  Breast carcinoma
  Breast lobular carcinoma
  Carcinoma
  Colorectal carcinoma
  Dementia
  Diabetic kidney disease
  Epithelial neoplasm
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Herpes simplex infection
  Macrocephaly, acquired, with impaired intellectual development
  Polycythemia vera
  Schizophrenia
  Small-cell lung cancer
  Squamous cell carcinoma
  Triple negative breast cancer
  Bone osteosarcoma
  Intellectual disability
  Megalencephaly
  Neuroblastoma
  Neurofibromatosis
  Neurofibromatosis type 1
  Hydrocephalus
  Alzheimer disease
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
• UniProt ID: NFIB_HUMAN
• Pfam ID: PF00859 ; PF03165 ; PF10524
• Sequence:
  MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
  LLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDC
  LRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFL
  AYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFP
  IGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS
  RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTP
  PPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG
• Function: Transcriptional activator of GFAP, essential for proper brain development. Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
• Reactome Pathway:
  RNA Polymerase III Abortive And Retractive Initiation (R-HSA-749476)
  RNA Polymerase III Transcription Termination (R-HSA-73980)

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Osteosarcoma	DISLQ7E2	Definitive	Genetic Variation	[1]
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[2]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[3]
Adenoma	DIS78ZEV	Strong	Genetic Variation	[4]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Amyloidosis	DISHTAI2	Strong	Biomarker	[7]
Astrocytoma	DISL3V18	Strong	Altered Expression	[5]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[8]
Benign prostatic hyperplasia	DISI3CW2	Strong	Biomarker	[9]
Bone giant cell tumor	DIS0RGK9	Strong	Altered Expression	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Breast lobular carcinoma	DISBY98Q	Strong	Genetic Variation	[12]
Carcinoma	DISH9F1N	Strong	Altered Expression	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[6]
Dementia	DISXL1WY	Strong	Biomarker	[14]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[15]
Epithelial neoplasm	DIS0T594	Strong	Biomarker	[16]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[3]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[17]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[5]
Glioma	DIS5RPEH	Strong	Biomarker	[18]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[19]
Macrocephaly, acquired, with impaired intellectual development	DISX5ADI	Strong	Autosomal dominant	[20]
Polycythemia vera	DISB5FPO	Strong	Biomarker	[21]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[22]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[3]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[24]
Bone osteosarcoma	DIST1004	moderate	Genetic Variation	[1]
Intellectual disability	DISMBNXP	moderate	Biomarker	[20]
Megalencephaly	DISYW5SV	moderate	Genetic Variation	[20]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[25]
Neurofibromatosis	DIS5N2R6	moderate	Biomarker	[26]
Neurofibromatosis type 1	DIS53JH9	moderate	Biomarker	[26]
Hydrocephalus	DISIZUF7	Disputed	Biomarker	[27]
Alzheimer disease	DISF8S70	Limited	Biomarker	[28]
Lung cancer	DISCM4YA	Limited	Biomarker	[29]
Lung carcinoma	DISTR26C	Limited	Biomarker	[29]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[30]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Nuclear factor 1 B-type (NFIB) affects the response to substance of Temozolomide.	[55]
DTI-015	DMXZRW0	Approved	Nuclear factor 1 B-type (NFIB) affects the response to substance of DTI-015.	[55]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Nuclear factor 1 B-type (NFIB).	[31]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nuclear factor 1 B-type (NFIB).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Nuclear factor 1 B-type (NFIB).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nuclear factor 1 B-type (NFIB).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nuclear factor 1 B-type (NFIB).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nuclear factor 1 B-type (NFIB).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Nuclear factor 1 B-type (NFIB).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Nuclear factor 1 B-type (NFIB).	[38]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Nuclear factor 1 B-type (NFIB).	[39]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Nuclear factor 1 B-type (NFIB).	[40]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Nuclear factor 1 B-type (NFIB).	[41]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Nuclear factor 1 B-type (NFIB).	[42]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Nuclear factor 1 B-type (NFIB).	[43]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Nuclear factor 1 B-type (NFIB).	[44]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Nuclear factor 1 B-type (NFIB).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Nuclear factor 1 B-type (NFIB).	[42]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Nuclear factor 1 B-type (NFIB).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Nuclear factor 1 B-type (NFIB).	[47]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Nuclear factor 1 B-type (NFIB).	[48]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Nuclear factor 1 B-type (NFIB).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Nuclear factor 1 B-type (NFIB).	[50]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Nuclear factor 1 B-type (NFIB).	[51]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Nuclear factor 1 B-type (NFIB).	[52]
Manganese	DMKT129	Investigative	Manganese increases the expression of Nuclear factor 1 B-type (NFIB).	[54]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Nuclear factor 1 B-type (NFIB).	[53]

References

• [1] A Genome-Wide Scan Identifies Variants in NFIB Associated with Metastasis in Patients with Osteosarcoma.Cancer Discov. 2015 Sep;5(9):920-31. doi: 10.1158/2159-8290.CD-15-0125. Epub 2015 Jun 17.
• [2] Microarray analysis to identify the similarities and differences of pathogenesis between aortic occlusive disease and abdominal aortic aneurysm.Vascular. 2018 Jun;26(3):301-314. doi: 10.1177/1708538117736695. Epub 2017 Oct 31.
• [3] Prognostic significance of NFIA and NFIB in esophageal squamous carcinoma and esophagogastric junction adenocarcinoma.Cancer Med. 2018 May;7(5):1756-1765. doi: 10.1002/cam4.1434. Epub 2018 Mar 25.
• [4] Identification of NFIB as recurrent translocation partner gene of HMGIC in pleomorphic adenomas.Oncogene. 1998 Feb 19;16(7):865-72. doi: 10.1038/sj.onc.1201609.
• [5] Transcription factors NFIA and NFIB induce cellular differentiation in high-grade astrocytoma.J Neurooncol. 2020 Jan;146(1):41-53. doi: 10.1007/s11060-019-03352-3. Epub 2019 Nov 23.
• [6] miR-302a Inhibits Metastasis and Cetuximab Resistance in Colorectal Cancer by Targeting NFIB and CD44.Theranostics. 2019 Oct 22;9(26):8409-8425. doi: 10.7150/thno.36605. eCollection 2019.
• [7] Age-Related Intraneuronal Aggregation of Amyloid- in Endosomes, Mitochondria, Autophagosomes, and Lysosomes.J Alzheimers Dis. 2020;73(1):229-246. doi: 10.3233/JAD-190835.
• [8] Cut-like homeobox 1 and nuclear factor I/B mediate ENGRAILED2 autism spectrum disorder-associated haplotype function.Hum Mol Genet. 2012 Apr 1;21(7):1566-80. doi: 10.1093/hmg/ddr594. Epub 2011 Dec 16.
• [9] Nfib Regulates Transcriptional Networks That Control the Development of Prostatic Hyperplasia.Endocrinology. 2016 Mar;157(3):1094-109. doi: 10.1210/en.2015-1312. Epub 2015 Dec 17.
• [10] MicroRNA expression profiles in metastatic and non-metastatic giant cell tumor of bone.Histol Histopathol. 2013 May;28(5):671-8. doi: 10.14670/HH-28.671. Epub 2012 Nov 21.
• [11] ER Binding by Transcription Factors NFIB and YBX1 Enables FGFR2 Signaling to Modulate Estrogen Responsiveness in Breast Cancer.Cancer Res. 2018 Jan 15;78(2):410-421. doi: 10.1158/0008-5472.CAN-17-1153. Epub 2017 Nov 27.
• [12] Histological types of breast cancer: how special are they?.Mol Oncol. 2010 Jun;4(3):192-208. doi: 10.1016/j.molonc.2010.04.004. Epub 2010 Apr 18.
• [13] Recurrent fusion of MYB and NFIB transcription factor genes in carcinomas of the breast and head and neck.Proc Natl Acad Sci U S A. 2009 Nov 3;106(44):18740-4. doi: 10.1073/pnas.0909114106. Epub 2009 Oct 19.
• [14] - but not -secretase proteolysis of APP causes synaptic and memory deficits in a mouse model of dementia.EMBO Mol Med. 2012 Mar;4(3):171-9. doi: 10.1002/emmm.201100195. Epub 2012 Jan 23.
• [15] Cell adhesion molecule-1 shedding induces apoptosis of renal epithelial cells and exacerbates human nephropathies.Am J Physiol Renal Physiol. 2018 Mar 1;314(3):F388-F398. doi: 10.1152/ajprenal.00385.2017. Epub 2017 Oct 25.
• [16] Analysis of MYB expression and MYB-NFIB gene fusions in adenoid cystic carcinoma and other salivary neoplasms.Mod Pathol. 2011 Sep;24(9):1169-76. doi: 10.1038/modpathol.2011.86. Epub 2011 May 13.
• [17] BCL6 degradation caused by the interaction with the C-terminus of pro-HB-EGF induces cyclin D2 expression in gastric cancers.Br J Cancer. 2009 Apr 21;100(8):1320-9. doi: 10.1038/sj.bjc.6605010. Epub 2009 Mar 31.
• [18] MicroRNA-346 inhibits the growth of glioma by directly targeting NFIB.Cancer Cell Int. 2019 Nov 14;19:294. doi: 10.1186/s12935-019-1017-5. eCollection 2019.
• [19] Two transcriptional activators, CCAAT-box-binding transcription factor and heat shock transcription factor, interact with a human hsp70 gene promoter.Mol Cell Biol. 1987 Mar;7(3):1129-38. doi: 10.1128/mcb.7.3.1129-1138.1987.
• [20] NFIB Haploinsufficiency Is Associated with Intellectual Disability and Macrocephaly. Am J Hum Genet. 2018 Nov 1;103(5):752-768. doi: 10.1016/j.ajhg.2018.10.006.
• [21] Transcriptional profiling of polycythemia vera identifies gene expression patterns both dependent and independent from the action of JAK2V617F.Clin Cancer Res. 2010 Sep 1;16(17):4339-52. doi: 10.1158/1078-0432.CCR-10-1092. Epub 2010 Jul 2.
• [22] Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
• [23] NFIB overexpression cooperates with Rb/p53 deletion to promote small cell lung cancer.Oncotarget. 2016 Sep 6;7(36):57514-57524. doi: 10.18632/oncotarget.11583.
• [24] MYBL1 rearrangements and MYB amplification in breast adenoid cystic carcinomas lacking the MYB-NFIB fusion gene.J Pathol. 2018 Feb;244(2):143-150. doi: 10.1002/path.5006. Epub 2017 Dec 28.
• [25] Evidence that intramolecular associations between presenilin domains are obligatory for endoproteolytic processing.J Biol Chem. 1999 May 14;274(20):13818-23. doi: 10.1074/jbc.274.20.13818.
• [26] Characterization and utilization of an international neurofibromatosis web-based, patient-entered registry: An observational study.PLoS One. 2017 Jun 23;12(6):e0178639. doi: 10.1371/journal.pone.0178639. eCollection 2017.
• [27] Nuclear factor I X deficiency causes brain malformation and severe skeletal defects. Mol Cell Biol. 2007 May;27(10):3855-3867. doi: 10.1128/MCB.02293-06.
• [28] NRBF2 is involved in the autophagic degradation process of APP-CTFs in Alzheimer disease models.Autophagy. 2017;13(12):2028-2040. doi: 10.1080/15548627.2017.1379633.
• [29] A large-scale analysis of alternative splicing reveals a key role of QKI in lung cancer.Mol Oncol. 2016 Nov;10(9):1437-1449. doi: 10.1016/j.molonc.2016.08.001. Epub 2016 Aug 9.
• [30] Intertumoral Heterogeneity in SCLC Is Influenced by the Cell Type of Origin.Cancer Discov. 2018 Oct;8(10):1316-1331. doi: 10.1158/2159-8290.CD-17-0987. Epub 2018 Sep 18.
• [31] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [32] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [33] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [34] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [38] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [39] Influence of Iron on Cytotoxicity and Gene Expression Profiles Induced by Arsenic in HepG2 Cells. Int J Environ Res Public Health. 2019 Nov 14;16(22):4484. doi: 10.3390/ijerph16224484.
• [40] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [41] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [42] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [43] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [44] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [45] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [46] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [47] Comparative mechanisms of PAH toxicity by benzo[a]pyrene and dibenzo[def,p]chrysene in primary human bronchial epithelial cells cultured at air-liquid interface. Toxicol Appl Pharmacol. 2019 Sep 15;379:114644.
• [48] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] Genome-wide gene expression profiling of low-dose, long-term exposure of human osteosarcoma cells to bisphenol A and its analogs bisphenols AF and S. Toxicol In Vitro. 2015 Aug;29(5):1060-9.
• [51] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [52] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [53] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [54] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [55] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.