Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXMXPIH)

• DOT Name: Rho-related GTP-binding protein RhoE (RND3)
• Synonyms: Protein MemB; Rho family GTPase 3; Rho-related GTP-binding protein Rho8; Rnd3
• Gene Name: RND3
• Related Disease:
  Gastric neoplasm
  Adenoma
  Adult glioblastoma
  Advanced cancer
  Cardiac failure
  Congestive heart failure
  Dilated cardiomyopathy
  Esophageal adenocarcinoma
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Hydrocephalus
  Malignant glioma
  Malignant soft tissue neoplasm
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Prostate neoplasm
  Sarcoma
  Lung cancer
  Lung carcinoma
  Melanoma
  Metastatic malignant neoplasm
  Obesity
  Squamous cell carcinoma
  Breast carcinoma
  Cardiomyopathy
• UniProt ID: RND3_HUMAN
• PDB ID: 1M7B; 2V55; 4BG6; 7OBC; 7OBD; 8B2K; 8BFC
• Pfam ID: PF00071
• Sequence:
  MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENY
  TASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGE
  IQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL
  QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKS
  CTVM
• Function: Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins.
• Tissue Specificity: Ubiquitous.
• Reactome Pathway: RND3 GTPase cycle (R-HSA-9696264)

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric neoplasm	DISOKN4Y	Definitive	Altered Expression	[1]
Adenoma	DIS78ZEV	Strong	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Cardiac failure	DISDC067	Strong	Biomarker	[5]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[5]
Dilated cardiomyopathy	DISX608J	Strong	Biomarker	[5]
Esophageal adenocarcinoma	DISODWFP	Strong	Genetic Variation	[6]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[7]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[8]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Hydrocephalus	DISIZUF7	Strong	Biomarker	[11]
Malignant glioma	DISFXKOV	Strong	Biomarker	[12]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[14]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[15]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[16]
Sarcoma	DISZDG3U	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	moderate	Biomarker	[4]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[17]
Melanoma	DIS1RRCY	moderate	Biomarker	[18]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[19]
Obesity	DIS47Y1K	moderate	Altered Expression	[20]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[21]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[22]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[20]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Rho-related GTP-binding protein RhoE (RND3).	[23]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[24]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[25]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[26]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[27]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[28]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[28]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Rho-related GTP-binding protein RhoE (RND3).	[29]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[30]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[31]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Rho-related GTP-binding protein RhoE (RND3).	[32]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[33]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[34]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[35]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[36]
Nicotine	DMWX5CO	Approved	Nicotine increases the splicing of Rho-related GTP-binding protein RhoE (RND3).	[37]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[38]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[39]
Cidofovir	DMA13GD	Approved	Cidofovir affects the expression of Rho-related GTP-binding protein RhoE (RND3).	[25]
Clodronate	DM9Y6X7	Approved	Clodronate affects the expression of Rho-related GTP-binding protein RhoE (RND3).	[25]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[40]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[44]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[45]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Rho-related GTP-binding protein RhoE (RND3).	[46]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[47]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[48]
CHLORANIL	DMCHGF1	Investigative	CHLORANIL increases the expression of Rho-related GTP-binding protein RhoE (RND3).	[49]

References

• [1] RhoE enhances multidrug resistance of gastric cancer cells by suppressing Bax.Biochem Biophys Res Commun. 2009 Feb 6;379(2):212-6. doi: 10.1016/j.bbrc.2008.12.044. Epub 2008 Dec 25.
• [2] Up-regulated miR-17 promotes cell proliferation, tumour growth and cell cycle progression by targeting the RND3 tumour suppressor gene in colorectal carcinoma.Biochem J. 2012 Mar 1;442(2):311-21. doi: 10.1042/BJ20111517.
• [3] RND3 promotes Snail 1 protein degradation and inhibits glioblastoma cell migration and invasion.Oncotarget. 2016 Dec 13;7(50):82411-82423. doi: 10.18632/oncotarget.12396.
• [4] Rnd3 in Cancer: A Review of the Evidence for Tumor Promoter or Suppressor.Mol Cancer Res. 2016 Nov;14(11):1033-1044. doi: 10.1158/1541-7786.MCR-16-0164. Epub 2016 Aug 23.
• [5] Rnd3/RhoE Modulates Hypoxia-Inducible Factor 1/Vascular Endothelial Growth Factor Signaling by Stabilizing Hypoxia-Inducible Factor 1 and Regulates Responsive Cardiac Angiogenesis.Hypertension. 2016 Mar;67(3):597-605. doi: 10.1161/HYPERTENSIONAHA.115.06412. Epub 2016 Jan 18.
• [6] Interactions Between Genetic Variants and Environmental Factors Affect Risk of Esophageal Adenocarcinoma and Barrett's Esophagus.Clin Gastroenterol Hepatol. 2018 Oct;16(10):1598-1606.e4. doi: 10.1016/j.cgh.2018.03.007. Epub 2018 Mar 15.
• [7] The Rho GTPase RhoE exerts tumor-suppressing effects in human esophageal squamous cell carcinoma via negatively regulating epidermal growth factor receptor.J Cancer Res Ther. 2016 Oct;12(Supplement):60-63. doi: 10.4103/0973-1482.191633.
• [8] Small GTPase RHOE/RND3, a new critical regulator of NF-B signalling in glioblastoma multiforme?.Cell Prolif. 2019 Sep;52(5):e12665. doi: 10.1111/cpr.12665. Epub 2019 Jul 22.
• [9] Long Non-Coding RNA HOXA-AS2 Enhances The Malignant Biological Behaviors In Glioma By Epigenetically Regulating RND3 Expression.Onco Targets Ther. 2019 Nov 7;12:9407-9419. doi: 10.2147/OTT.S225678. eCollection 2019.
• [10] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [11] Genetic deletion of Rnd3 results in aqueductal stenosis leading to hydrocephalus through up-regulation of Notch signaling.Proc Natl Acad Sci U S A. 2013 May 14;110(20):8236-41. doi: 10.1073/pnas.1219995110. Epub 2013 Apr 29.
• [12] Inference of Low and High-Grade Glioma Gene Regulatory Networks Delineates the Role of Rnd3 in Establishing Multiple Hallmarks of Cancer.PLoS Genet. 2015 Jul 1;11(7):e1005325. doi: 10.1371/journal.pgen.1005325. eCollection 2015 Jul.
• [13] Reduced expression of the ROCK inhibitor Rnd3 is associated with increased invasiveness and metastatic potential in mesenchymal tumor cells.PLoS One. 2010 Nov 30;5(11):e14154. doi: 10.1371/journal.pone.0014154.
• [14] Deciphering the scalene association among type-2 diabetes mellitus, prostate cancer, and chronic myeloid leukemia via enrichment analysis of disease-gene network.Cancer Med. 2019 May;8(5):2268-2277. doi: 10.1002/cam4.1845. Epub 2019 Apr 1.
• [15] Rnd3 regulates lung cancer cell proliferation through notch signaling.PLoS One. 2014 Nov 5;9(11):e111897. doi: 10.1371/journal.pone.0111897. eCollection 2014.
• [16] Small G-protein RhoE is underexpressed in prostate cancer and induces cell cycle arrest and apoptosis.Prostate. 2005 Sep 1;64(4):332-40. doi: 10.1002/pros.20243.
• [17] microRNA-802/Rnd3 pathway imposes on carcinogenesis and metastasis of fine particulate matter exposure.Oncotarget. 2016 Jun 7;7(23):35026-43. doi: 10.18632/oncotarget.9019.
• [18] A switch in RND3-RHOA signaling is critical for melanoma cell invasion following mutant-BRAF inhibition.Mol Cancer. 2011 Sep 14;10:114. doi: 10.1186/1476-4598-10-114.
• [19] Pathophysiological Functions of Rnd3/RhoE.Compr Physiol. 2015 Dec 15;6(1):169-86. doi: 10.1002/cphy.c150018.
• [20] The Rho GTPase RND3 regulates adipocyte lipolysis.Metabolism. 2019 Dec;101:153999. doi: 10.1016/j.metabol.2019.153999. Epub 2019 Oct 28.
• [21] Small GTPase RhoE/Rnd3 is a critical regulator of Notch1 signaling.Cancer Res. 2014 Apr 1;74(7):2082-93. doi: 10.1158/0008-5472.CAN-12-0452. Epub 2014 Feb 13.
• [22] The Rho GTPase RhoE is a p53-regulated candidate tumor suppressor in cancer cells.Int J Oncol. 2014 Mar;44(3):896-904. doi: 10.3892/ijo.2014.2245. Epub 2014 Jan 7.
• [23] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [24] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [25] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [26] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [27] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [28] Grouping of histone deacetylase inhibitors and other toxicants disturbing neural crest migration by transcriptional profiling. Neurotoxicology. 2015 Sep;50:56-70.
• [29] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [30] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [31] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [32] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [33] Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [36] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [37] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [38] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [39] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [40] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [41] Highly active combination of BRD4 antagonist and histone deacetylase inhibitor against human acute myelogenous leukemia cells. Mol Cancer Ther. 2014 May;13(5):1142-54.
• [42] Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
• [43] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [44] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [45] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [46] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [47] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [48] Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
• [49] Redox-active quinones induces genome-wide DNA methylation changes by an iron-mediated and Tet-dependent mechanism. Nucleic Acids Res. 2014 Feb;42(3):1593-605. doi: 10.1093/nar/gkt1090. Epub 2013 Nov 8.