Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZCA5LK)

• DOT Name: Heat shock 70 kDa protein 14 (HSPA14)
• Synonyms: HSP70-like protein 1; Heat shock protein HSP60
• Gene Name: HSPA14
• Related Disease:
  Gastritis
  Lung adenocarcinoma
  Advanced cancer
  Alzheimer disease
  Ankylosing spondylitis
  B-cell neoplasm
  Behcet disease
  Bladder cancer
  Breast neoplasm
  Carcinoma
  Cardiovascular disease
  Colitis
  Coronary atherosclerosis
  Epithelial ovarian cancer
  Inflammatory bowel disease
  Juvenile idiopathic arthritis
  Myocardial infarction
  Neuroblastoma
  Non-small-cell lung cancer
  Obesity
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Periodontitis
  Pneumonia
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Rheumatoid arthritis
  Tuberculosis
  Type-1 diabetes
  Type-1/2 diabetes
  Ulcerative colitis
  Urinary bladder neoplasm
  Chronic obstructive pulmonary disease
  Clear cell renal carcinoma
  Neoplasm
  Arthritis
  Coronary heart disease
  Hepatocellular carcinoma
  Hereditary spastic paraplegia
  High blood pressure
  Matthew-Wood syndrome
  Mouth disorder
  Multiple sclerosis
  Non-insulin dependent diabetes
  Pancreatic cancer
  Thyroid gland papillary carcinoma
• UniProt ID: HSP7E_HUMAN
• Pfam ID: PF00012
• Sequence:
  MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNI
  SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI
  FSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAY
  GIGQDSPTGKSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLA
  SEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARF
  ELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNS
  IPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
  PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVL
  TMKRDGSLHVTCTDQETGKCEAISIEIAS
• Function: Component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity.
• Reactome Pathway: Regulation of HSF1-mediated heat shock response (R-HSA-3371453)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastritis	DIS8G07K	Definitive	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[5]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[6]
Behcet disease	DISSYMBS	Strong	Biomarker	[7]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[8]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[9]
Carcinoma	DISH9F1N	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[11]
Colitis	DISAF7DD	Strong	Biomarker	[12]
Coronary atherosclerosis	DISKNDYU	Strong	Genetic Variation	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[14]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[15]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[16]
Myocardial infarction	DIS655KI	Strong	Biomarker	[17]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Obesity	DIS47Y1K	Strong	Biomarker	[20]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[14]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[14]
Periodontitis	DISI9JOI	Strong	Biomarker	[22]
Pneumonia	DIS8EF3M	Strong	Biomarker	[23]
Prostate cancer	DISF190Y	Strong	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[24]
Psoriasis	DIS59VMN	Strong	Altered Expression	[6]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[25]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[26]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[28]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[29]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[30]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[31]
Clear cell renal carcinoma	DISBXRFJ	moderate	Altered Expression	[32]
Neoplasm	DISZKGEW	Disputed	Biomarker	[14]
Arthritis	DIST1YEL	Limited	Biomarker	[33]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[34]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[35]
Hereditary spastic paraplegia	DISGZQV1	Limited	Genetic Variation	[36]
High blood pressure	DISY2OHH	Limited	Biomarker	[37]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[38]
Mouth disorder	DISX82BI	Limited	Biomarker	[39]
Multiple sclerosis	DISB2WZI	Limited	Altered Expression	[40]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[41]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[38]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Altered Expression	[42]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Heat shock 70 kDa protein 14 (HSPA14).	[43]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Heat shock 70 kDa protein 14 (HSPA14).	[44]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[45]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[46]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[47]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[48]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Heat shock 70 kDa protein 14 (HSPA14).	[49]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[50]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[51]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[52]
Arecoline	DMFJZK3	Phase 1	Arecoline increases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[55]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Heat shock 70 kDa protein 14 (HSPA14).	[56]

References

• [1] Immune response in Helicobacter pylori-induced low-grade gastric-mucosa-associated lymphoid tissue (MALT) lymphoma.J Med Microbiol. 2004 Jan;53(Pt 1):21-29. doi: 10.1099/jmm.0.05348-0.
• [2] The bioenergetic signature of lung adenocarcinomas is a molecular marker of cancer diagnosis and prognosis.Carcinogenesis. 2004 Jul;25(7):1157-63. doi: 10.1093/carcin/bgh113. Epub 2004 Feb 12.
• [3] Correction: HSP70L1-mediated intracellular priming of dendritic cell vaccination induces more potent CTL response against cancer.Cell Mol Immunol. 2020 Jan;17(1):108-109. doi: 10.1038/s41423-019-0335-9.
• [4] Heat Shock Proteins in Alzheimer's Disease: Role and Targeting.Int J Mol Sci. 2018 Sep 1;19(9):2603. doi: 10.3390/ijms19092603.
• [5] Antibodies against recombinant heat shock proteins of 60 kDa from enterobacteria in the sera and synovial fluid of HLA-B27 positive ankylosing spondylitis patients.Clin Exp Rheumatol. 2009 Jul-Aug;27(4):626-32.
• [6] Effect of alterations in apoptotic pathway on development of metabolic syndrome in patients with psoriasis vulgaris.Br J Dermatol. 2017 Jun;176(6):1549-1557. doi: 10.1111/bjd.15185. Epub 2017 Apr 10.
• [7] Evaluation of the relationship between salivary concentration of anti-heat shock protein immunoglobulin and clinical manifestations of Behet's disease.Scand J Rheumatol. 2017 Sep;46(5):381-387. doi: 10.1080/03009742.2016.1249942. Epub 2017 Feb 14.
• [8] Relationship between heat shock protein 60 (HSP60) mRNA expression and resistance to platinum analogues in human ovarian and bladder carcinoma cell lines.Cancer Lett. 1997 Oct 28;119(1):63-70. doi: 10.1016/s0304-3835(97)00255-3.
• [9] Anti-breast tumor activity of Eclipta extract in-vitro and in-vivo: novel evidence of endoplasmic reticulum specific localization of Hsp60 during apoptosis.Sci Rep. 2015 Dec 17;5:18457. doi: 10.1038/srep18457.
• [10] Efficient induction of a Her2-specific anti-tumor response by dendritic cells pulsed with a Hsp70L1-Her2(341-456) fusion protein.Cell Mol Immunol. 2011 Sep;8(5):424-32. doi: 10.1038/cmi.2011.21. Epub 2011 Jul 25.
• [11] Induction of Dendritic Cell-Mediated Activation of T Cells From Atherosclerotic Plaques by Human Heat Shock Protein 60.J Am Heart Assoc. 2017 Nov 18;6(11):e006778. doi: 10.1161/JAHA.117.006778.
• [12] Elongated Flexuous Plant Virus-Derived Nanoparticles Functionalized for Autoantibody Detection.Nanomaterials (Basel). 2019 Oct 10;9(10):1438. doi: 10.3390/nano9101438.
• [13] Plasma heat shock protein 60 and cardiovascular disease risk: the role of psychosocial, genetic, and biological factors.Cell Stress Chaperones. 2007 Winter;12(4):384-92. doi: 10.1379/csc-300.1.
• [14] HSP60-regulated Mitochondrial Proteostasis and Protein Translation Promote Tumor Growth of Ovarian Cancer.Sci Rep. 2019 Sep 2;9(1):12628. doi: 10.1038/s41598-019-48992-7.
• [15] Hsp60 as a Novel Target in IBD Management: A Prospect.Front Pharmacol. 2019 Feb 8;10:26. doi: 10.3389/fphar.2019.00026. eCollection 2019.
• [16] Peripheral blood mononuclear cell responses to heat shock proteins and their derived synthetic peptides in juvenile idiopathic arthritis patients.Inflamm Res. 2006 Apr;55(4):153-9. doi: 10.1007/s00011-006-0065-1.
• [17] -Caryophyllene as a Potential Protective Agent Against Myocardial Injury: The Role of Toll-Like Receptors.Molecules. 2019 May 19;24(10):1929. doi: 10.3390/molecules24101929.
• [18] CCAR2/DBC1 and Hsp60 Positively Regulate Expression of Survivin in Neuroblastoma Cells.Int J Mol Sci. 2019 Jan 1;20(1):131. doi: 10.3390/ijms20010131.
• [19] Chaperonin (HSP60) and annexin-2 are candidate biomarkers for non-small cell lung carcinoma.Medicine (Baltimore). 2017 Feb;96(6):e5903. doi: 10.1097/MD.0000000000005903.
• [20] Autoimmunity to HSP60 during diet induced obesity in mice.Int J Obes (Lond). 2017 Feb;41(2):348-351. doi: 10.1038/ijo.2016.216. Epub 2016 Nov 30.
• [21] Chaperonin 60 regulation of SOX9 ubiquitination mitigates the development of knee osteoarthritis.J Mol Med (Berl). 2016 Jul;94(7):755-69. doi: 10.1007/s00109-016-1422-3. Epub 2016 Apr 27.
• [22] Natural Monoclonal Antibody to Oxidized Low-Density Lipoprotein and Aggregatibacter actinomycetemcomitans.Methods Mol Biol. 2017;1643:155-167. doi: 10.1007/978-1-4939-7180-0_12.
• [23] Long-Term Efficacy and Safety of Immunomodulatory Therapy for Atherosclerosis.Cardiovasc Drugs Ther. 2019 Aug;33(4):385-398. doi: 10.1007/s10557-019-06890-0.
• [24] The Multiple Roles and Therapeutic Potential of Molecular Chaperones in Prostate Cancer.Cancers (Basel). 2019 Aug 16;11(8):1194. doi: 10.3390/cancers11081194.
• [25] Autoantibodies to heat shock proteins 60, 70, and 90 in patients with rheumatoid arthritis.Cell Stress Chaperones. 2019 Jan;24(1):283-287. doi: 10.1007/s12192-018-0951-9. Epub 2018 Nov 21.
• [26] Peptide 19 of Porphyromonas gingivalis Heat Shock Protein Is a Potent Inducer of Low-Density Lipoprotein Oxidation.J Periodontol. 2017 Feb;88(2):e58-e64. doi: 10.1902/jop.2016.160402. Epub 2016 Oct 7.
• [27] T cells and autoantibodies to human HSP70 in type 1 diabetes in children.J Autoimmun. 2003 Jun;20(4):313-21. doi: 10.1016/s0896-8411(03)00038-6.
• [28] Endothelial TNF- induction by Hsp60 secreted from THP-1 monocytes exposed to hyperglycaemic conditions.Cell Stress Chaperones. 2018 Jul;23(4):519-525. doi: 10.1007/s12192-017-0858-x. Epub 2017 Nov 13.
• [29] Changes in immunohistochemical levels and subcellular localization after therapy and correlation and colocalization with CD68 suggest a pathogenetic role of Hsp60 in ulcerative colitis.Appl Immunohistochem Mol Morphol. 2011 Dec;19(6):552-61. doi: 10.1097/PAI.0b013e3182118e5f.
• [30] Heat shock proteins 60 and 70 are associated with long-term outcome of T1-stage high-grade urothelial tumors of the bladder treated with intravesical Bacillus Calmette-Gurin immunotherapy.Urol Oncol. 2018 Dec;36(12):531.e9-531.e17. doi: 10.1016/j.urolonc.2018.09.007. Epub 2018 Oct 15.
• [31] HSP60 activity on human bronchial epithelial cells.Int J Immunopathol Pharmacol. 2017 Dec;30(4):333-340. doi: 10.1177/0394632017734479. Epub 2017 Oct 4.
• [32] HSP60 silencing promotes Warburg-like phenotypes and switches the mitochondrial function from ATP production to biosynthesis in ccRCC cells.Redox Biol. 2019 Jun;24:101218. doi: 10.1016/j.redox.2019.101218. Epub 2019 May 14.
• [33] Targeting of tolerogenic dendritic cells to heat-shock proteins in inflammatory arthritis.J Transl Med. 2019 Nov 14;17(1):375. doi: 10.1186/s12967-019-2128-4.
• [34] Salivary IgA to MAA-LDL and Oral Pathogens Are Linked to Coronary Disease.J Dent Res. 2019 Mar;98(3):296-303. doi: 10.1177/0022034518818445. Epub 2019 Jan 22.
• [35] Targeting HSP60 by subcutaneous injections of jetPEI/HSP60-shRNA destabilizes cytoplasmic survivin and inhibits hepatocellular carcinoma growth.Mol Carcinog. 2018 Sep;57(9):1087-1101. doi: 10.1002/mc.22827. Epub 2018 May 2.
• [36] The Hsp60-(p.V98I) mutation associated with hereditary spastic paraplegia SPG13 compromises chaperonin function both in vitro and in vivo.J Biol Chem. 2008 Jun 6;283(23):15694-700. doi: 10.1074/jbc.M800548200. Epub 2008 Apr 8.
• [37] Adaptive Immunity in Hypertension.Curr Hypertens Rep. 2019 Jul 18;21(9):68. doi: 10.1007/s11906-019-0971-6.
• [38] Oncogenic HSP60 regulates mitochondrial oxidative phosphorylation to support Erk1/2 activation during pancreatic cancer cell growth.Cell Death Dis. 2018 Feb 7;9(2):161. doi: 10.1038/s41419-017-0196-z.
• [39] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [40] Gamma delta T-cell receptor repertoire in acute multiple sclerosis lesions.Proc Natl Acad Sci U S A. 1992 May 15;89(10):4588-92. doi: 10.1073/pnas.89.10.4588.
• [41] Association of humoral immunity to human Hsp60 with the IL-6 gene polymorphism C-174G in patients with type 2 diabetes and controls.Horm Metab Res. 2005 Apr;37(4):257-63. doi: 10.1055/s-2005-861209.
• [42] Differential protein expression of lymph node metastases of papillary thyroid carcinoma harboring the BRAF mutation.Anticancer Res. 2013 Oct;33(10):4357-64.
• [43] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [44] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [45] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [46] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [47] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [48] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [49] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [50] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [51] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [52] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [53] Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
• [54] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [55] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.