Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZGAF8B)

• DOT Name: Alpha-2-antiplasmin (SERPINF2)
• Synonyms: Alpha-2-AP; Alpha-2-plasmin inhibitor; Alpha-2-PI; Serpin F2
• Gene Name: SERPINF2
• Related Disease:
  Alpha-2-plasmin inhibitor deficiency
  Abdominal aortic aneurysm
  Acute liver failure
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Attention deficit hyperactivity disorder
  Cerebral infarction
  Creutzfeldt Jacob disease
  Cystic fibrosis
  Endometrial carcinoma
  Hereditary angioedema
  High blood pressure
  Major depressive disorder
  Metabolic disorder
  Myocardial infarction
  Non-insulin dependent diabetes
  Osteoarthritis
  Parkinson disease
  Periodontitis
  Rheumatoid arthritis
  Rhinitis
  Schizophrenia
  Squamous cell carcinoma
  Thrombophilia
  Urinary tract infection
  Epithelial ovarian cancer
  Methicillin-resistant staphylococci infection
  Neoplasm
  Neurofibromatosis
  Neurofibromatosis type 1
  Thrombocytopenia
  Thrombotic thrombocytopenic purpura
  Type-1/2 diabetes
  Acute graft versus host disease
  Asthma
  Bleeding disorder
  Bronchiolitis
  Coagulation defect
  Dental caries
  Hyperlipidemia
  Hyperlipoproteinemia
  Stroke
  Systemic sclerosis
• UniProt ID: A2AP_HUMAN
• Pfam ID: PF00079
• Sequence:
  MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQ
  TALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
  ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
  QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
  WRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
  LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
  QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
  EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
  EEDYPQFGSPK
• Function: Serine protease inhibitor. The major targets of this inhibitor are plasmin and trypsin, but it also inactivates matriptase-3/TMPRSS7 and chymotrypsin.
• Tissue Specificity: Expressed by the liver and secreted in plasma.
• KEGG Pathway: Complement and coagulation cascades (hsa04610)
• Reactome Pathway:
  Dissolution of Fibrin Clot (R-HSA-75205)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alpha-2-plasmin inhibitor deficiency	DISZ2FSN	Definitive	Autosomal recessive	[1]
Abdominal aortic aneurysm	DISD06OF	Strong	Genetic Variation	[2]
Acute liver failure	DIS5EZKX	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[6]
Cerebral infarction	DISR1WNP	Strong	Genetic Variation	[2]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Genetic Variation	[7]
Cystic fibrosis	DIS2OK1Q	Strong	Biomarker	[8]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[9]
Hereditary angioedema	DIS8X53J	Strong	Altered Expression	[10]
High blood pressure	DISY2OHH	Strong	Biomarker	[11]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[12]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[13]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[14]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[15]
Osteoarthritis	DIS05URM	Strong	Biomarker	[16]
Parkinson disease	DISQVHKL	Strong	Biomarker	[17]
Periodontitis	DISI9JOI	Strong	Biomarker	[18]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[16]
Rhinitis	DISKLMN7	Strong	Biomarker	[19]
Schizophrenia	DISSRV2N	Strong	Biomarker	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[21]
Thrombophilia	DISQR7U7	Strong	Biomarker	[5]
Urinary tract infection	DISMT6UV	Strong	Genetic Variation	[22]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[23]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[24]
Neoplasm	DISZKGEW	moderate	Biomarker	[25]
Neurofibromatosis	DIS5N2R6	moderate	Biomarker	[26]
Neurofibromatosis type 1	DIS53JH9	moderate	Biomarker	[26]
Thrombocytopenia	DISU61YW	Disputed	Altered Expression	[27]
Thrombotic thrombocytopenic purpura	DIS3LDOU	Disputed	Altered Expression	[27]
Type-1/2 diabetes	DISIUHAP	Disputed	Biomarker	[28]
Acute graft versus host disease	DIS8KLVM	Limited	Biomarker	[29]
Asthma	DISW9QNS	Limited	Biomarker	[30]
Bleeding disorder	DIS27CUA	Limited	Biomarker	[31]
Bronchiolitis	DISEE9BG	Limited	Biomarker	[32]
Coagulation defect	DIS9X3H6	Limited	Biomarker	[33]
Dental caries	DISRBCMD	Limited	Biomarker	[34]
Hyperlipidemia	DIS61J3S	Limited	Biomarker	[35]
Hyperlipoproteinemia	DISVBLBO	Limited	Biomarker	[35]
Stroke	DISX6UHX	Limited	Biomarker	[36]
Systemic sclerosis	DISF44L6	Limited	Biomarker	[37]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID27977313-Compound-29	DMIF7KG	Patented	Alpha-2-antiplasmin (SERPINF2) increases the Coagulation factor decreased ADR of PMID27977313-Compound-29.	[51]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[38]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Alpha-2-antiplasmin (SERPINF2).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[43]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[39]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Alpha-2-antiplasmin (SERPINF2).	[40]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Alpha-2-antiplasmin (SERPINF2).	[45]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[46]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[47]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[48]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Alpha-2-antiplasmin (SERPINF2).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Alpha-2-antiplasmin (SERPINF2).	[50]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Alpha-2-antiplasmin Arg407Lys polymorphism and cryptogenic ischemic cerebrovascular events: Association with neurological deficit.Neurol Neurochir Pol. 2018 May-Jun;52(3):352-358. doi: 10.1016/j.pjnns.2017.12.009. Epub 2017 Dec 26.
• [3] Protective effects of p-coumaric acid against acetaminophen-induced hepatotoxicity in mice.Food Chem Toxicol. 2018 Nov;121:131-139. doi: 10.1016/j.fct.2018.08.060. Epub 2018 Aug 24.
• [4] Association studies between the plasmin genes and late-onset Alzheimer's disease.Neurobiol Aging. 2007 Jul;28(7):1041-3. doi: 10.1016/j.neurobiolaging.2006.05.028. Epub 2006 Jul 7.
• [5] Proteomic analysis of plasma from children with sickle cell anemia and silent cerebral infarction.Haematologica. 2018 Jul;103(7):1136-1142. doi: 10.3324/haematol.2018.187815. Epub 2018 Mar 15.
• [6] A Systematic Review and Evaluation of Clinical Practice Guidelines for Children and Youth with Disruptive Behavior: Rigor of Development and Recommendations for Use.Clin Child Fam Psychol Rev. 2019 Dec;22(4):527-548. doi: 10.1007/s10567-019-00292-2.
• [7] Genome-wide study links MTMR7 gene to variant Creutzfeldt-Jakob risk.Neurobiol Aging. 2012 Jul;33(7):1487.e21-8. doi: 10.1016/j.neurobiolaging.2011.10.011. Epub 2011 Dec 2.
• [8] Characterization of Streptococcus milleri group isolates from expectorated sputum of adult patients with cystic fibrosis.J Clin Microbiol. 2010 Feb;48(2):395-401. doi: 10.1128/JCM.01807-09. Epub 2009 Dec 9.
• [9] Inhibition of AKT survival pathway by a small molecule inhibitor in human endometrial cancer cells.Br J Cancer. 2004 Nov 15;91(10):1808-12. doi: 10.1038/sj.bjc.6602214.
• [10] Elevated plasmin-alpha 2-antiplasmin complex levels in hereditary angioedema: evidence for the in vivo efficiency of the intrinsic fibrinolytic system.Thromb Res. 1985 Dec 15;40(6):817-21. doi: 10.1016/0049-3848(85)90318-4.
• [11] Clinical Implications of the Revised AAP Pediatric Hypertension Guidelines.Pediatrics. 2018 Aug;142(2):e20180245. doi: 10.1542/peds.2018-0245. Epub 2018 Jul 5.
• [12] Medication Adherence, Health Care Utilization, and Costs in Patients With Major Depressive Disorder Initiating Adjunctive Atypical Antipsychotic Treatment.Clin Ther. 2019 Feb;41(2):221-232. doi: 10.1016/j.clinthera.2018.12.005. Epub 2019 Jan 5.
• [13] Effects of air pollution exposure on glucose metabolism in Los Angeles minority children.Pediatr Obes. 2018 Jan;13(1):54-62. doi: 10.1111/ijpo.12188. Epub 2016 Dec 6.
• [14] Proteolytic and genetic variation of the alpha-2-antiplasmin C-terminus in myocardial infarction.Blood. 2011 Jun 16;117(24):6694-701. doi: 10.1182/blood-2010-11-320325. Epub 2011 Apr 19.
• [15] Sex-specific alteration to 2-antiplasmin incorporation in patients with type 2 diabetes.Thromb Res. 2020 Jan;185:55-62. doi: 10.1016/j.thromres.2019.09.032. Epub 2019 Oct 21.
• [16] Thrombin in the synovial fluid of patients with rheumatoid arthritis mediates proliferation of synovial fibroblast-like cells by induction of platelet derived growth factor.J Rheumatol. 1996 Sep;23(9):1505-11.
• [17] Phase lag index and spectral power as QEEG features for identification of patients with mild cognitive impairment in Parkinson's disease.Clin Neurophysiol. 2019 Oct;130(10):1937-1944. doi: 10.1016/j.clinph.2019.07.017. Epub 2019 Jul 25.
• [18] Obesity and periodontitis in Australian adults: A population-based cross-sectional study.Int Dent J. 2020 Feb;70(1):53-61. doi: 10.1111/idj.12514. Epub 2019 Aug 30.
• [19] Differences between preschoolers with asthma and allergies in urban and rural environments.J Asthma. 2018 May;55(5):470-476. doi: 10.1080/02770903.2017.1339800. Epub 2017 Jul 21.
• [20] Schizophrenia-risk and urban birth are associated with proteomic changes in neonatal dried blood spots.Transl Psychiatry. 2017 Dec 18;7(12):1290. doi: 10.1038/s41398-017-0027-0.
• [21] Induction of alpha2-antiplasmin inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion.Oncol Rep. 2007 Feb;17(2):417-23.
• [22] Aerococcus urinae and Aerococcus sanguinicola, two frequently misidentified uropathogens.Scand J Infect Dis. 2010 Oct;42(10):775-80. doi: 10.3109/00365548.2010.485576.
• [23] Expression of trypsinogen-1, trypsinogen-2, and tumor-associated trypsin inhibitor in ovarian cancer: prognostic study on tissue and serum.Clin Cancer Res. 2004 Jul 15;10(14):4761-8. doi: 10.1158/1078-0432.CCR-0204-03.
• [24] Molecular identification and characterization of mannitol-negative methicillin-resistant Staphylococcus aureus.Diagn Microbiol Infect Dis. 2007 Jan;57(1):93-5. doi: 10.1016/j.diagmicrobio.2006.05.004. Epub 2006 Jul 18.
• [25] Survival differences by race/ethnicity among children and adolescents diagnosed with germ cell tumors.Int J Cancer. 2020 May 1;146(9):2433-2441. doi: 10.1002/ijc.32569. Epub 2019 Jul 31.
• [26] Precise localization of NF1 to 17q11.2 by balanced translocation.Am J Hum Genet. 1989 Jan;44(1):20-4.
• [27] Plasmin cleavage of von Willebrand factor as an emergency bypass for ADAMTS13 deficiency in thrombotic microangiopathy.Circulation. 2014 Mar 25;129(12):1320-31. doi: 10.1161/CIRCULATIONAHA.113.006727. Epub 2014 Jan 21.
• [28] The level of circulating fibroblast activation protein correlates with incorporation of alpha-2-antiplasmin into the fibrin clot.Thromb Res. 2018 Jun;166:19-21. doi: 10.1016/j.thromres.2018.03.018. Epub 2018 Apr 3.
• [29] A critical role of the Gas6-Mer axis in endothelial dysfunction contributing to TA-TMA associated with GVHD.Blood Adv. 2019 Jul 23;3(14):2128-2143. doi: 10.1182/bloodadvances.2019000222.
• [30] Preschoolers with recurrent wheezing have a high prevalence of sleep disordered breathing.J Asthma. 2020 Jun;57(6):584-592. doi: 10.1080/02770903.2019.1599385. Epub 2019 Apr 5.
• [31] A single thymine nucleotide deletion responsible for congenital deficiency of plasmin inhibitor.Thromb Haemost. 2002 Jul;88(1):144-8.
• [32] The impact of the recent AAP changes in palivizumab authorization on RSV-induced bronchiolitis severity and incidence.Ital J Pediatr. 2017 Aug 14;43(1):71. doi: 10.1186/s13052-017-0390-8.
• [33] Alpha2-antiplasmin and its deficiency: fibrinolysis out of balance.Haemophilia. 2008 Nov;14(6):1250-4. doi: 10.1111/j.1365-2516.2008.01766.x.
• [34] Self-reported oral health predicts tooth loss after five and ten years in a population-based study.J Clin Periodontol. 2018 Oct;45(10):1164-1172. doi: 10.1111/jcpe.12997. Epub 2018 Sep 6.
• [35] Changes in coagulative and fibrinolytic activities in Triton WR-1339-induced hyperlipidemia in rats.Jpn J Pharmacol. 1990 Feb;52(2):353-61. doi: 10.1254/jjp.52.353.
• [36] Matrix Metalloproteinase-9 Mediates the Deleterious Effects of 2-Antiplasmin on Blood-Brain Barrier Breakdown and Ischemic Brain Injury in Experimental Stroke.Neuroscience. 2018 Apr 15;376:40-47. doi: 10.1016/j.neuroscience.2017.12.021. Epub 2017 Dec 30.
• [37] 2AP regulates vascular alteration by inhibiting VEGF signaling in systemic sclerosis: the roles of 2AP in vascular dysfunction in systemic sclerosis.Arthritis Res Ther. 2017 Feb 3;19(1):22. doi: 10.1186/s13075-017-1227-y.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [40] Hemostatic abnormalities associated with acute promyelocytic leukemia and corrective effects of all-trans-retinoic acid or arsenic trioxide treatment. Chin Med J (Engl). 2000 Mar;113(3):236-40.
• [41] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [44] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [45] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [46] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [47] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [48] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [49] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [50] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [51] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.