Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZLCQ5U)

• DOT Name: Sororin (CDCA5)
• Synonyms: Cell division cycle-associated protein 5; p35
• Gene Name: CDCA5
• Related Disease:
  Melanoma
  Alzheimer disease
  Amyloidosis
  Astrocytoma
  Autism spectrum disorder
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cardiovascular disease
  Crohn disease
  Esophageal squamous cell carcinoma
  Gastric cancer
  Hepatitis B virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Immunodeficiency
  Liver cancer
  Lung cancer
  Lung carcinoma
  Lyme disease
  Neoplasm
  Non-hodgkin lymphoma
  Non-small-cell lung cancer
  Osteosarcoma
  Prostate carcinoma
  Psoriasis
  Rheumatoid arthritis
  Schizophrenia
  Stomach cancer
  Stroke
  Systemic lupus erythematosus
  Systemic sclerosis
  Advanced cancer
  Colorectal carcinoma
  Fetal growth restriction
  Matthew-Wood syndrome
  Neuroblastoma
  Ovarian cancer
  Pancreatic ductal carcinoma
  Malaria
  Metastatic malignant neoplasm
  Epithelial ovarian cancer
  Intellectual disability
  Nervous system disease
  Ovarian neoplasm
  Pancreatic cancer
  Type-1 diabetes
• UniProt ID: CDCA5_HUMAN
• Pfam ID: PF09666
• Sequence:
  MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVL
  KRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNP
  EAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGV
  SPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAE
  FEAAEQFDLLVE
• Function: Regulator of sister chromatid cohesion in mitosis stabilizing cohesin complex association with chromatin. May antagonize the action of WAPL which stimulates cohesin dissociation from chromatin. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair. Required for efficient DNA double-stranded break repair.
• KEGG Pathway:
  Cell cycle (hsa04110)
  MicroR.s in cancer (hsa05206)
• Reactome Pathway:
  Establishment of Sister Chromatid Cohesion (R-HSA-2468052)
  Resolution of Sister Chromatid Cohesion (R-HSA-2500257)
  Separation of Sister Chromatids (R-HSA-2467813)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Altered Expression	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Amyloidosis	DISHTAI2	Strong	Genetic Variation	[3]
Astrocytoma	DISL3V18	Strong	Altered Expression	[4]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[8]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[9]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[10]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[11]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[12]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[16]
Liver cancer	DISDE4BI	Strong	Biomarker	[8]
Lung cancer	DISCM4YA	Strong	Altered Expression	[17]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[17]
Lyme disease	DISO70G5	Strong	Altered Expression	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[21]
Psoriasis	DIS59VMN	Strong	Biomarker	[22]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[23]
Schizophrenia	DISSRV2N	Strong	Biomarker	[24]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[12]
Stroke	DISX6UHX	Strong	Biomarker	[25]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[26]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[27]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[12]
Colorectal carcinoma	DIS5PYL0	moderate	Altered Expression	[28]
Fetal growth restriction	DIS5WEJ5	moderate	Biomarker	[29]
Matthew-Wood syndrome	DISA7HR7	moderate	Genetic Variation	[30]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[31]
Ovarian cancer	DISZJHAP	moderate	Altered Expression	[32]
Pancreatic ductal carcinoma	DIS26F9Q	moderate	Biomarker	[30]
Malaria	DISQ9Y50	Disputed	Biomarker	[33]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Biomarker	[34]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[32]
Intellectual disability	DISMBNXP	Limited	Genetic Variation	[35]
Nervous system disease	DISJ7GGT	Limited	Altered Expression	[36]
Ovarian neoplasm	DISEAFTY	Limited	Altered Expression	[32]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[37]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[38]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Sororin (CDCA5).	[39]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sororin (CDCA5).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Sororin (CDCA5).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Sororin (CDCA5).	[42]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Sororin (CDCA5).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Sororin (CDCA5).	[44]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Sororin (CDCA5).	[45]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Sororin (CDCA5).	[46]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Sororin (CDCA5).	[47]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Sororin (CDCA5).	[48]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Sororin (CDCA5).	[48]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Sororin (CDCA5).	[49]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Sororin (CDCA5).	[50]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Sororin (CDCA5).	[51]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Sororin (CDCA5).	[52]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Sororin (CDCA5).	[53]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Sororin (CDCA5).	[54]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Sororin (CDCA5).	[55]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Sororin (CDCA5).	[56]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Sororin (CDCA5).	[57]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Sororin (CDCA5).	[58]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Sororin (CDCA5).	[59]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Sororin (CDCA5).	[61]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Sororin (CDCA5).	[62]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Sororin (CDCA5).	[63]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Sororin (CDCA5).	[64]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Sororin (CDCA5).	[66]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Sororin (CDCA5).	[45]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide increases the expression of Sororin (CDCA5).	[67]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Sororin (CDCA5).	[63]
ORG2058	DMH1M6N	Investigative	ORG2058 decreases the expression of Sororin (CDCA5).	[68]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Sororin (CDCA5).	[60]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Sororin (CDCA5).	[65]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Sororin (CDCA5).	[65]

References

• [1] Gene expression screening identifies CDCA5 as a potential therapeutic target in acral melanoma.Hum Pathol. 2018 May;75:137-145. doi: 10.1016/j.humpath.2018.02.009. Epub 2018 Feb 13.
• [2] p35 Hemizygous Deletion in 5xFAD Mice Increases A Plaque Load in Males but Not in Females.Neuroscience. 2019 Oct 1;417:45-56. doi: 10.1016/j.neuroscience.2019.08.017. Epub 2019 Aug 14.
• [3] Inhibition of p25/Cdk5 Attenuates Tauopathy in Mouse and iPSC Models of Frontotemporal Dementia.J Neurosci. 2017 Oct 11;37(41):9917-9924. doi: 10.1523/JNEUROSCI.0621-17.2017. Epub 2017 Sep 14.
• [4] Cdk5 mediates changes in morphology and promotes apoptosis of astrocytoma cells in response to heat shock.J Cell Sci. 2001 Mar;114(Pt 6):1145-53. doi: 10.1242/jcs.114.6.1145.
• [5] Deletion of 11q12.3-11q13.1 in a patient with intellectual disability and childhood facial features resembling Cornelia de Lange syndrome.Gene. 2015 Nov 1;572(1):130-134. doi: 10.1016/j.gene.2015.07.016. Epub 2015 Jul 8.
• [6] p35 is required for CDK5 activation in cellular senescence.J Biol Chem. 2010 May 7;285(19):14671-80. doi: 10.1074/jbc.M109.066118. Epub 2010 Feb 24.
• [7] Distinct expression of CDCA3, CDCA5, and CDCA8 leads to shorter relapse free survival in breast cancer patient.Oncotarget. 2018 Jan 9;9(6):6977-6992. doi: 10.18632/oncotarget.24059. eCollection 2018 Jan 23.
• [8] CDCA5, Transcribed by E2F1, Promotes Oncogenesis by Enhancing Cell Proliferation and Inhibiting Apoptosis via the AKT Pathway in Hepatocellular Carcinoma.J Cancer. 2019 Apr 21;10(8):1846-1854. doi: 10.7150/jca.28809. eCollection 2019.
• [9] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [10] Specific seroreactivity of Crohn's disease patients against p35 and p36 antigens of M. avium subsp. paratuberculosis.Vet Microbiol. 2000 Dec 20;77(3-4):497-504. doi: 10.1016/s0378-1135(00)00334-5.
• [11] Systematic cancer-testis gene expression analysis identified CDCA5 as a potential therapeutic target in esophageal squamous cell carcinoma.EBioMedicine. 2019 Aug;46:54-65. doi: 10.1016/j.ebiom.2019.07.030. Epub 2019 Jul 16.
• [12] Upregulation of CDCA5 promotes gastric cancer malignant progression via influencing cyclin E1.Biochem Biophys Res Commun. 2018 Feb 5;496(2):482-489. doi: 10.1016/j.bbrc.2018.01.046. Epub 2018 Jan 8.
• [13] Polypeptides coded for by the region pre-S and gene S of hepatitis B virus DNA with the receptor for polymerized human serum albumin: expression on hepatitis B particles produced in the HBeAg or anti-HBe phase of hepatitis B virus infection.J Immunol. 1986 May 1;136(9):3467-72.
• [14] Impaired allostimulatory capacity of peripheral blood dendritic cells recovered from hepatitis C virus-infected individuals.J Immunol. 1999 May 1;162(9):5584-91.
• [15] Aberrantly DNA Methylated-Differentially Expressed Genes and Pathways in Hepatocellular Carcinoma.J Cancer. 2019 Jan 1;10(2):355-366. doi: 10.7150/jca.27832. eCollection 2019.
• [16] Molecular analysis of decreased interleukin-12 production in persons infected with human immunodeficiency virus.J Infect Dis. 1996 Jul;174(1):46-53. doi: 10.1093/infdis/174.1.46.
• [17] Achaete-scute homologue-1 (ASH1) stimulates migration of lung cancer cells through Cdk5/p35 pathway.Mol Biol Cell. 2012 Aug;23(15):2856-66. doi: 10.1091/mbc.E10-12-1010. Epub 2012 Jun 13.
• [18] Differential expression of Borrelia burgdorferi genes during erythema migrans and Lyme arthritis.J Infect Dis. 1998 Oct;178(4):1198-201. doi: 10.1086/515684.
• [19] Th1/Th2 cytokine expression and its relationship with tumor growth in B cell non-Hodgkin's lymphoma (NHL).Leuk Lymphoma. 2002 Jun;43(6):1313-21. doi: 10.1080/10428190290026385.
• [20] Identification of novel biomarkers and candidate small molecule drugs in non-small-cell lung cancer by integrated microarray analysis.Onco Targets Ther. 2019 May 13;12:3545-3563. doi: 10.2147/OTT.S198621. eCollection 2019.
• [21] Involvement of Cdk5/p25 in digoxin-triggered prostate cancer cell apoptosis.J Biol Chem. 2004 Jul 9;279(28):29302-7. doi: 10.1074/jbc.M403664200. Epub 2004 Apr 30.
• [22] Clinical Significance of Decreased Interleukin-35 Expression in Patients with Psoriasis.Microbiol Immunol. 2018 May 26. doi: 10.1111/1348-0421.12605. Online ahead of print.
• [23] Pro-inflammatory effects of interleukin-35 in rheumatoid arthritis.Cytokine. 2015 May;73(1):36-43. doi: 10.1016/j.cyto.2015.01.019. Epub 2015 Feb 16.
• [24] Schizophrenia is associated with dysregulation of a Cdk5 activator that regulates synaptic protein expression and cognition.Brain. 2011 Aug;134(Pt 8):2408-21. doi: 10.1093/brain/awr155. Epub 2011 Jul 19.
• [25] Zinc induces CDK5 activation and neuronal death through CDK5-Tyr15 phosphorylation in ischemic stroke.Cell Death Dis. 2018 Aug 29;9(9):870. doi: 10.1038/s41419-018-0929-7.
• [26] Decreased IL-12 production by polymorphonuclear leukocytes in patients with active systemic lupus erythematosus.Immunol Invest. 2002 Aug-Nov;31(3-4):177-89. doi: 10.1081/imm-120016239.
• [27] The non-neuronal cyclin-dependent kinase 5 is a fibrotic mediator potentially implicated in systemic sclerosis and a novel therapeutic target.Oncotarget. 2017 Dec 20;9(12):10294-10306. doi: 10.18632/oncotarget.23516. eCollection 2018 Feb 13.
• [28] Cell division cycle associated 5 promotes colorectal cancer progression by activating the ERK signaling pathway.Oncogenesis. 2019 Feb 26;8(3):19. doi: 10.1038/s41389-019-0123-5.
• [29] Intrauterine Growth Restriction Alters the Postnatal Development of the Rat Cerebellum.Dev Neurosci. 2017;39(1-4):215-227. doi: 10.1159/000470902. Epub 2017 Apr 28.
• [30] Cyclin-dependent kinase 5 is amplified and overexpressed in pancreatic cancer and activated by mutant K-Ras.Clin Cancer Res. 2011 Oct 1;17(19):6140-50. doi: 10.1158/1078-0432.CCR-10-2288. Epub 2011 Aug 8.
• [31] Induction of cyclin-dependent kinase 5 and its activator p35 through the extracellular-signal-regulated kinase and protein kinase A pathways during retinoic-acid mediated neuronal differentiation in human neuroblastoma SK-N-BE(2)C cells.J Neurochem. 2004 Nov;91(3):634-47. doi: 10.1111/j.1471-4159.2004.02770.x.
• [32] High IL-12 p35 and IL-23 p19 mRNA expression is associated with superior outcome in ovarian cancer.Gynecol Oncol. 2010 Sep;118(3):244-50. doi: 10.1016/j.ygyno.2010.05.024. Epub 2010 Jun 17.
• [33] A replication study of the association between the IL12B promoter allele CTCTAA and susceptibility to cerebral malaria in Thai population.Malar J. 2009 Dec 11;8:290. doi: 10.1186/1475-2875-8-290.
• [34] Pathway crosstalk analysis in prostate cancer based on protein-protein network data.Neoplasma. 2017;64(1):22-31. doi: 10.4149/neo_2017_103.
• [35] Effects of p35 Mutations Associated with Mental Retardation on the Cellular Function of p35-CDK5.PLoS One. 2015 Oct 15;10(10):e0140821. doi: 10.1371/journal.pone.0140821. eCollection 2015.
• [36] Calpastatin, an endogenous calpain-inhibitor protein, regulates the cleavage of the Cdk5 activator p35 to p25.J Neurochem. 2011 May;117(3):504-15. doi: 10.1111/j.1471-4159.2011.07222.x. Epub 2011 Mar 15.
• [37] Pancreatic cancer-associated inflammation drives dynamic regulation of p35 and Ebi3.Cytokine. 2020 Jan;125:154817. doi: 10.1016/j.cyto.2019.154817. Epub 2019 Aug 28.
• [38] Impaired processing and presentation by MHC class II proteins in human diabetic cells.J Immunol. 2003 Jan 1;170(1):620-7. doi: 10.4049/jimmunol.170.1.620.
• [39] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [42] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [43] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [44] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [45] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [46] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [47] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [48] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [49] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [50] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [51] Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
• [52] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [53] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [54] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [55] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [56] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [57] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [58] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [59] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [60] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [61] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [62] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [63] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [64] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [65] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [66] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [67] Comparative analysis of AhR-mediated TCDD-elicited gene expression in human liver adult stem cells. Toxicol Sci. 2009 Nov;112(1):229-44.
• [68] The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.