Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEYGVN4)

DME Name UDP-glucuronosyltransferase 1A1 (UGT1A1)
Synonyms
UDP-glucuronosyltransferase family 1 member A1; UDP-glucuronosyltransferase 1-A; UDP-glucuronosyltransferase 1-1; Bilirubin-specific UDPGT isozyme 1; UDPGT 1-1; UGT-1A; GNT1; UGT1; UGT1*1; UGT1-01; UGT1.1; UGT1A; UGT1A1; hUG-BR1
Gene Name UGT1A1
UniProt ID
UD11_HUMAN
INTEDE ID
DME0004
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54658
EC Number EC: 2.4.1.17
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVL
APDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDS
AMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLE
FEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQR
EVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
GIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDL
LGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS
EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Function This enzyme catalyzes the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone.
KEGG Pathway
Ascorbate and aldarate metabolism (hsa00053 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucuronidation (R-HSA-156588 )
Defective UGT1A1 causes hyperbilirubinemia (R-HSA-5579002 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
102 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Abacavir DMMN36E Human immunodeficiency virus infection 1C62 Approved [2]
Acetaminophen DMUIE76 Pain MG30-MG3Z Approved [3]
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [4]
Anastrozole DMNP60F Breast cancer 2C60-2C65 Approved [5]
Arry-162 DM1P6FR Melanoma 2C30 Approved [6]
Aspirin DM672AH Myocardial infarction BA41-BA43 Approved [7]
Atazanavir DMSYRBX Human immunodeficiency virus infection 1C62 Approved [8]
Atorvastatin DMF28YC Cardiovascular disease BA00-BE2Z Approved [9]
Axitinib DMGVH6N Renal cell carcinoma 2C90 Approved [10]
Bazedoxifene DMY85QW Osteopetrosis LD24.10 Approved [11]
Buprenorphine DMPRI8G Pain MG30-MG3Z Approved [12]
Candesartan DMRK8OT Hypertension BA00-BA04 Approved [13]
Carvedilol DMHTEAO Congestive heart failure BD10 Approved [14]
Cerivastatin DMXCM7H Hyperlipidaemia 5C80 Approved [15]
Chenodiol DMQ8JIK Cholelithiasis DC11 Approved [16]
Codeine DMJX6ZG Pain MG30-MG3Z Approved [17]
Cyproheptadine DM92AH3 Rhinitis FA20 Approved [18]
Darolutamide DMV7YFT Prostate cancer 2C82.0 Approved [19]
Deferasirox DM6ETS0 Hypophosphatasia 5C64.3 Approved [20]
Dexibuprofen DMFYBD0 Ankylosing spondylitis FA92.0 Approved [21]
Diflunisal DM7EN8I Pain MG30-MG3Z Approved [22]
Digitoxin DMWVIGP Arrhythmia BC9Z Approved [23]
Dolutegravir DMCZGRE Human immunodeficiency virus infection 1C62 Approved [24]
Eltrombopag DMOGFIX Thrombocytopenia 3B64 Approved [25]
Elvitegravir DMG9B1U Human immunodeficiency virus infection 1C62 Approved [26]
Epinephrine DM3KJBC Allergy 4A80-4A85 Approved [27]
Eslicarbazepine DMZREFQ Seizure disorder 8A6Z Approved [28]
Estradiol DMUNTE3 Breast cancer 2C60-2C65 Approved [29]
Estradiol acetate DM07U2A Hormone replacement therapy 8E01 Approved [29]
Estradiol cypionate DM27Z5T Hormone replacement therapy 8E01 Approved [29]
Estradiol valerate DM8MC6O Hormone replacement therapy 8E01 Approved [29]
Estriol DMOEM2I Hormone deficiency 5A61.1 Approved [30]
Ethanol DMDRQZU Chronic pain MG30 Approved [31]
Ethinyl estradiol DMODJ40 Female hypogonadism GA30.6 Approved [14]
Etodolac DM6WJO9 Pain MG30-MG3Z Approved [32]
Etoposide DMNH3PG Solid tumour/cancer 2A00-2F9Z Approved [33]
Ezetimibe DM7A8TW Hypercholesterolaemia 5C80.0 Approved [34]
Febuxostat DMDEXQ0 Hyperuricaemia 5C55.Y Approved [35]
Flurbiprofen DMGN4BY Rheumatoid arthritis FA20 Approved [36]
Fulvestrant DM0YZC6 Breast cancer 2C60-2C65 Approved [37]
Furosemide DMMQ8ZG Congestive heart failure BD10 Approved [14]
Fusidic acid DMWVCF3 Bacterial infection 1A00-1C4Z Approved [38]
Gemfibrozil DMD8Q3J Hyperlipidaemia 5C80 Approved [39]
Glibenclamide DM8JXPZ Diabetic complication 5A2Y Approved [40]
Glipizide DMZA5PQ Diabetic complication 5A2Y Approved [14]
Hydrocodone bitartrate DMIAPBE Neuropathic pain 8E43.0 Approved [41]
Hydromorphone DMHP21E Pain MG30-MG3Z Approved [42]
Hydroxyprogesterone DMIKQH5 Solid tumour/cancer 2A00-2F9Z Approved [43]
Imipramine DM2NUH3 Depression 6A70-6A7Z Approved [4]
Indacaterol DMQJHR7 Chronic obstructive pulmonary disease CA22 Approved [44]
Indinavir DM0T3YH Human immunodeficiency virus infection 1C62 Approved [45]
Indomethacin DMSC4A7 Rheumatoid arthritis FA20 Approved [21]
Itraconazole DMCR1MV Fungal infection 1F29-1F2F Approved [46]
Ketoprofen DMRKXPT Musculoskeletal pain MG30 Approved [47]
Labetalol DMK8U72 Hypertension BA00-BA04 Approved [48]
Lamotrigine DM8SXYG Bipolar disorder 6A60 Approved [14]
Levothyroxine DMHN027 Hypothyroidism 5A00 Approved [14]
Liothyronine DM6IR3P Hypothyroidism 5A00 Approved [49]
Losartan DM72JXH Hypertension BA00-BA04 Approved [13]
Lovastatin DM9OZWQ Hypercholesterolaemia 5C80.0 Approved [50]
MCI-186 DM8ZHP1 Amyotrophic lateral sclerosis 8B60.0 Approved [51]
Meprobamate DMHM93Y Anxiety disorder 6B00-6B0Z Approved [52]
Mercaptopurine DMTM2IK Acute lymphoblastic leukaemia 2A85 Approved [53]
Metronidazole DMTIVEN Amoebiasis 1A36 Approved [14]
Minoxidil DMA2Z4F Hypertension BA00-BA04 Approved [54]
MK-8228 DMOB58Q Cytomegalovirus Disease 1D82 Approved [55]
Morphine DMRMS0L Chronic pain MG30 Approved [56]
Mycophenolate mofetil DMPQAGE Organ transplant rejection NE84 Approved [57]
Naltrexone DMUL45H Alcohol dependence 6C40.2 Approved [58]
Naproxen DMZ5RGV Osteoarthritis FA00-FA05 Approved [59]
Nicotine DMWX5CO Nicotine dependence 6C4A.2 Approved [4]
Niflumic acid DMJ3I1Q Rheumatoid arthritis FA20 Approved [60]
Oxazepam DMXNZM4 Anxiety disorder 6B00-6B0Z Approved [61]
Oxymetazoline DM8ZXT6 Eye inflammation 9A02 Approved [62]
Phenylbutazone DMAYL0T Chronic pain MG30 Approved [63]
Pirprofen DMMOFHT Dysmenorrhea GA34.3 Approved [64]
Pitavastatin calcium DM1UJO0 Dyslipidemia 5C80-5C81 Approved [65]
Posaconazole DMUL5EW Aspergillosis 1F20 Approved [66]
Probenecid DMMFWOJ Gout FA25 Approved [67]
Propofol DMB4OLE Anaesthesia 9A78.6 Approved [68]
Raloxifene DMDKF3M Osteoporosis FB83.0 Approved [14]
Raltegravir DMYURI6 Human immunodeficiency virus infection 1C62 Approved [69]
Repaglinide DM5SXUV Diabetic complication 5A2Y Approved [70]
Retigabine DMGNYIH Behcet disease 4A62 Approved [71]
Rilpivirine DMJ0QOW Human immunodeficiency virus infection 1C62 Approved [72]
Riluzole DMECBWN Amyotrophic lateral sclerosis 8B60.0 Approved [73]
Simvastatin DM30SGU Hypercholesterolaemia 5C80.0 Approved [50]
Suprofen DMKXJZ7 Miosis LA11.62 Approved [21]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [74]
Telmisartan DMS3GX2 Hypertension BA00-BA04 Approved [75]
Tiagabine DMKSQG0 Epilepsy 8A60-8A68 Approved [76]
Tramadol DMRQD04 Pain MG30-MG3Z Approved [14]
Trimipramine DM1SC8M Major depressive disorder 6A70.3 Approved [77]
Troglitazone DM3VFPD Diabetic complication 5A2Y Approved [78]
Valproate DMCFE9I Epilepsy 8A60-8A68 Approved [79]
Vorinostat DMWMPD4 Cutaneous T-cell lymphoma 2B01 Approved [80]
Warfarin DMJYCVW Atrial fibrillation BC81.3 Approved [81]
Zidovudine DM4KI7O Human immunodeficiency virus infection 1C62 Approved [82]
Zonisamide DM0DTF7 Epilepsy 8A60-8A68 Approved [76]
Dihydrotestosterone DM3S8XC Prostate hyperplasia GA90 Phase 4 [83]
Oleandomycin DMVAOME Respiratory infection CA07-CA4Z Phase 4 [84]
Silymarin DMXBYQR N. A. N. A. Phase 4 [85]
⏷ Show the Full List of 102 Approved Drug(s)
20 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ABT-492 DMJFD2I Bacterial infection 1A00-1C4Z Phase 3 [86]
Carisbamate DM4Y1SP Epilepsy 8A60-8A68 Phase 3 [87]
Curcumin DMQPH29 Solid tumour/cancer 2A00-2F9Z Phase 3 [88]
GSK1265744 DMT8J0I Human immunodeficiency virus infection 1C62 Phase 3 [89]
LCQ908 DMFLJHQ Familial chylomicronemia syndrome 5C80 Phase 3 [90]
Muraglitazar DMG3NFZ N. A. N. A. Phase 3 [91]
Selinexor DMBD4K3 Liposarcoma 2B59 Phase 3 [92]
Phenol DM1QSM3 N. A. N. A. Phase 2/3 [93]
ABT-751 DMNG35S Solid tumour/cancer 2A00-2F9Z Phase 2 [94]
Afimoxifene DMFORDT Breast cancer 2C60-2C65 Phase 2 [95]
BCP-13498 DM2BO9W Anaesthesia 9A78.6 Phase 2 [96]
Cicletanine DMGTZLW Pulmonary arterial hypertension BB01.0 Phase 2 [97]
Flavopiridol DMKSUOI Acute myeloid leukaemia 2A60 Phase 2 [14]
LE-SN38 DMW50NF Colorectal cancer 2B91.Z Phase 2 [98]
PDX-101 DM6OC53 Solid tumour/cancer 2A00-2F9Z Phase 2 [99]
Dapivirine DMJPSIL Human immunodeficiency virus infection 1C62 Phase 1/2 [100]
LM-94 DMW3QGJ Primary sclerosing cholangitis DB96.2 Phase 1/2 [101]
Capravirine DM9ERH1 Human immunodeficiency virus infection 1C62 Phase 1 [102]
GS-9883 DMMF5IE Human immunodeficiency virus infection 1C62 Phase 1 [103]
TAS-103 DM5WDKY Solid tumour/cancer 2A00-2F9Z Phase 1 [104]
⏷ Show the Full List of 20 Clinical Trial Drug(s)
1 Patented Agent(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Eugenol DM7US1H Discovery agent N.A. Patented [88]
3 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenolphthalein DM5SICT Constipation DD91.1 Withdrawn from market [105]
Gavestinel DM8IL1U Nerve injury ND56.4 Discontinued in Phase 2 [21]
VR-776 DMFQWNI Premature ejaculation HA03.0Z Discontinued in Phase 1 [77]
5 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ACMC-1AKLT DMRQ70X Discovery agent N.A. Investigative [29]
Anthraflavic acid DMN1YFU Discovery agent N.A. Investigative [88]
Chrysin DM7V2LG Discovery agent N.A. Investigative [88]
Cis-4-hydroxytamoxifen DMRFTB5 Discovery agent N.A. Investigative [95]
Phloretin DMYA50U Discovery agent N.A. Investigative [88]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Chrysin Discovery agent [N.A.] Investigative Km = 0.004 microM [88]
Phloretin Discovery agent [N.A.] Investigative Km = 0.0068 microM [88]
Eugenol Discovery agent [N.A.] Patented Km = 0.0084 microM [88]
Afimoxifene Breast cancer [2C60-2C65] Phase 2 Km = 0.004 microM [95]
Curcumin Solid tumour/cancer [2A00-2F9Z] Phase 3 Km = 0.1 microM [88]
Ethanol Chronic pain [MG30] Approved Km = 8.03 microM [31]
⏷ Show the Full List of 6 Drugs with Enzyme Kinetic Data

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.83E-07 8.08E-02 4.11E-01
Alopecia ED70 Skin from scalp 1.46E-01 -1.86E-02 -8.11E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.10E-01 -5.91E-02 -3.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.69E-01 9.30E-02 7.05E-01
Aortic stenosis BB70 Calcified aortic valve 1.84E-01 2.05E-01 8.91E-01
Apnea 7A40 Hyperplastic tonsil 3.44E-01 -2.67E-02 -1.48E-01
Arthropathy FA00-FA5Z Peripheral blood 9.48E-01 -8.54E-03 -6.13E-02
Asthma CA23 Nasal and bronchial airway 3.80E-01 -9.11E-03 -3.47E-02
Atopic dermatitis EA80 Skin 3.37E-04 -1.50E-01 -9.69E-01
Autism 6A02 Whole blood 2.69E-01 4.90E-02 1.88E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.04E-02 -2.20E-01 -1.16E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.60E-01 -5.65E-02 -4.75E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.17E-01 6.55E-02 2.04E-01
Batten disease 5C56.1 Whole blood 9.21E-01 -5.04E-02 -4.11E-01
Behcet's disease 4A62 Peripheral blood 6.15E-01 2.28E-02 1.18E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.03E-01 8.52E-02 6.41E-01
Bladder cancer 2C94 Bladder tissue 3.76E-02 9.81E-02 4.02E-01
Breast cancer 2C60-2C6Z Breast tissue 6.74E-01 -1.44E-02 -7.35E-02
Cardioembolic stroke 8B11.20 Whole blood 2.22E-04 2.15E-01 1.22E+00
Cervical cancer 2C77 Cervical tissue 2.40E-01 -7.00E-02 -3.69E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.37E-01 -3.42E-02 -1.12E-01
Chronic hepatitis C 1E51.1 Whole blood 9.82E-01 1.47E-02 6.84E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 8.29E-01 -5.44E-03 -2.25E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.23E-03 9.31E-02 4.30E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.93E-01 1.04E-02 8.52E-02
Colon cancer 2B90 Colon tissue 3.70E-05 -8.48E-02 -3.30E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.89E-01 -6.89E-02 -2.01E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.08E-01 7.98E-03 3.57E-02
Endometriosis GA10 Endometrium tissue 1.98E-01 1.01E-01 3.33E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.10E-01 1.41E-01 6.42E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.00E-01 5.79E-02 3.00E-01
Gastric cancer 2B72 Gastric tissue 7.39E-02 3.09E-01 2.24E+00
Glioblastopma 2A00.00 Nervous tissue 6.50E-01 1.30E-02 5.24E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.13E-01 -6.34E-02 -5.97E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.04E-04 -5.18E-01 -1.68E+00
Head and neck cancer 2D42 Head and neck tissue 1.04E-03 -7.68E-02 -3.85E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.34E-02 -7.88E-02 -1.98E-01
Huntington's disease 8A01.10 Whole blood 8.92E-01 -9.30E-02 -6.37E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.59E-01 8.21E-02 5.64E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.34E-01 1.78E-02 1.52E-01
Influenza 1E30 Whole blood 1.24E-02 4.20E-01 3.84E+00
Interstitial cystitis GC00.3 Bladder tissue 2.00E-02 1.81E-01 1.77E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.06E-01 -3.90E-02 -1.78E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.40E-01 -4.85E-04 -1.69E-03
Ischemic stroke 8B11 Peripheral blood 2.61E-01 -6.03E-02 -2.74E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.30E-01 -2.46E-02 -9.42E-02
Lateral sclerosis 8B60.4 Skin 6.40E-01 3.70E-02 1.48E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.01E-01 1.93E-01 4.52E-01
Liver cancer 2C12.0 Liver tissue 6.94E-01 1.98E-02 9.45E-02
Liver failure DB99.7-DB99.8 Liver tissue 9.52E-01 -4.37E-02 -2.04E-01
Lung cancer 2C25 Lung tissue 2.33E-02 1.75E-02 8.91E-02
Lupus erythematosus 4A40 Whole blood 2.19E-02 -3.33E-02 -7.37E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.87E-01 4.98E-02 3.61E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.17E-02 4.08E-02 1.59E-01
Melanoma 2C30 Skin 8.43E-01 1.95E-02 3.86E-02
Multiple myeloma 2A83.1 Peripheral blood 6.60E-01 2.51E-02 8.26E-02
Multiple myeloma 2A83.1 Bone marrow 8.62E-03 1.37E-01 8.67E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.69E-01 1.91E-02 5.45E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.18E-01 4.62E-02 2.36E-01
Myelofibrosis 2A20.2 Whole blood 8.65E-03 -6.65E-02 -4.13E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.86E-01 5.00E-02 1.43E-01
Myopathy 8C70.6 Muscle tissue 5.94E-01 -1.29E-01 -8.90E-01
Neonatal sepsis KA60 Whole blood 5.66E-04 -4.90E-02 -1.83E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.49E-01 7.94E-02 3.42E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.43E-01 -1.85E-02 -1.25E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.78E-01 -1.53E-02 -3.93E-01
Olive pollen allergy CA08.00 Peripheral blood 6.85E-01 -4.31E-02 -2.18E-01
Oral cancer 2B6E Oral tissue 5.98E-01 -5.34E-02 -2.12E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.11E-01 5.03E-03 2.97E-02
Osteoporosis FB83.1 Bone marrow 4.43E-01 4.28E-02 2.46E-01
Ovarian cancer 2C73 Ovarian tissue 7.11E-01 1.85E-01 5.52E-01
Pancreatic cancer 2C10 Pancreas 2.45E-01 -1.66E-01 -4.71E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.53E-01 4.14E-02 1.83E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.49E-02 -1.03E-01 -7.62E-01
Pituitary cancer 2D12 Pituitary tissue 1.83E-03 2.27E-01 1.62E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.42E-02 7.93E-02 4.07E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.39E-01 4.04E-02 1.42E-01
Polycythemia vera 2A20.4 Whole blood 1.23E-01 -4.00E-02 -2.26E-01
Pompe disease 5C51.3 Biceps muscle 4.05E-01 -1.01E-01 -5.06E-01
Preterm birth KA21.4Z Myometrium 2.91E-01 7.62E-02 6.08E-01
Prostate cancer 2C82 Prostate 2.60E-03 3.86E-01 8.02E-01
Psoriasis EA90 Skin 9.29E-06 -4.82E-01 -7.82E-01
Rectal cancer 2B92 Rectal colon tissue 1.87E-02 -4.28E-01 -1.94E+00
Renal cancer 2C90-2C91 Kidney 2.57E-01 8.93E-02 5.68E-01
Retinoblastoma 2D02.2 Uvea 3.14E-02 -1.16E-01 -6.08E-01
Rheumatoid arthritis FA20 Synovial tissue 9.12E-01 2.06E-01 3.41E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.08E-01 -3.22E-02 -3.06E-01
Schizophrenia 6A20 Prefrontal cortex 8.03E-01 9.92E-03 4.89E-02
Schizophrenia 6A20 Superior temporal cortex 1.42E-01 -4.97E-02 -3.73E-01
Scleroderma 4A42.Z Whole blood 7.26E-09 3.41E-01 4.05E+00
Seizure 8A60-8A6Z Whole blood 3.23E-01 -3.50E-02 -1.96E-01
Sensitive skin EK0Z Skin 5.34E-01 -2.43E-02 -1.99E-01
Sepsis with septic shock 1G41 Whole blood 1.46E-01 6.14E-02 1.89E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.66E-01 -1.22E-01 -3.85E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.29E-02 2.26E-01 1.23E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.03E-02 1.31E-01 1.81E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.19E-01 -2.73E-01 -1.01E+00
Skin cancer 2C30-2C3Z Skin 3.45E-18 -3.01E-01 -4.74E-01
Thrombocythemia 3B63 Whole blood 4.03E-01 2.82E-02 1.62E-01
Thrombocytopenia 3B64 Whole blood 5.31E-01 7.20E-02 4.31E-01
Thyroid cancer 2D10 Thyroid 5.73E-01 -2.96E-02 -1.22E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.96E-03 -1.95E-01 -8.72E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.43E-01 1.22E-01 3.50E-01
Type 2 diabetes 5A11 Liver tissue 5.20E-01 -3.27E-03 -2.84E-02
Ureter cancer 2C92 Urothelium 3.59E-01 -3.65E-02 -1.61E-01
Uterine cancer 2C78 Endometrium tissue 1.33E-18 2.66E-01 1.10E+00
Vitiligo ED63.0 Skin 3.47E-01 -1.58E-02 -6.45E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name UDP-glucuronosyltransferase 1A1 (UGT1A1) DTT Info
DME DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AT-342 DMSOQ6E Crigler-Najjar syndrome 5C58.00 Phase 1/2 [1]

References

1 ClinicalTrials.gov (NCT03223194) Gene Transfer Clinical Study in Crigler-Najjar Syndrome (VALENS). U.S. National Institutes of Health.
2 A review of the pharmacokinetics of abacavir. Clin Pharmacokinet. 2008;47(6):351-71.
3 Effect of UDP-glucuronosyltransferase (UGT) 1A polymorphism (rs8330 and rs10929303) on glucuronidation status of acetaminophen. Dose Response. 2017 Sep 11;15(3):1559325817723731.
4 Liquid chromatography-tandem mass spectrometry method for measurement of nicotine N-glucuronide: a marker for human UGT2B10 inhibition. J Pharm Biomed Anal. 2011 Jul 15;55(5):964-71.
5 In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
6 Binimetinib - European Medicines Agency - European Union
7 Pharmacogenomics in aspirin intolerance. Curr Drug Metab. 2009 Nov;10(9):998-1008.
8 In vitro inhibition of UDP glucuronosyltransferases by atazanavir and other HIV protease inhibitors and the relationship of this property to in vivo bilirubin glucuronidation. Drug Metab Dispos. 2005 Nov;33(11):1729-39.
9 Atorvastatin glucuronidation is minimally and nonselectively inhibited by the fibrates gemfibrozil, fenofibrate, and fenofibric acid. Drug Metab Dispos. 2007 Aug;35(8):1315-24.
10 Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
11 UGT1A1*28 polymorphism influences glucuronidation of bazedoxifene. Pharmazie. 2015 Feb;70(2):94-6.
12 Contribution of the different UDP-glucuronosyltransferase (UGT) isoforms to buprenorphine and norbuprenorphine metabolism and relationship with the main UGT polymorphisms in a bank of human liver microsomes. Drug Metab Dispos. 2010 Jan;38(1):40-5.
13 The human UDP-glucuronosyltransferase UGT1A3 is highly selective towards N2 in the tetrazole ring of losartan, candesartan, and zolarsartan. Biochem Pharmacol. 2008 Sep 15;76(6):763-72.
14 Drug-drug interactions for UDP-glucuronosyltransferase substrates: a pharmacokinetic explanation for typically observed low exposure (AUCi/AUC) ratios. Drug Metab Dispos. 2004 Nov;32(11):1201-8.
15 Cerivastatin, genetic variants, and the risk of rhabdomyolysis. Pharmacogenet Genomics. 2011 May;21(5):280-8.
16 Human UDP-glucuronosyltransferase (UGT)1A3 enzyme conjugates chenodeoxycholic acid in the liver. Hepatology. 2006 Nov;44(5):1158-70.
17 Evaluation of 3'-azido-3'-deoxythymidine, morphine, and codeine as probe substrates for UDP-glucuronosyltransferase 2B7 (UGT2B7) in human liver microsomes: specificity and influence of the UGT2B7*2 polymorphism. Drug Metab Dispos. 2003 Sep;31(9):1125-33.
18 Effect of common exon variant (p.P364L) on drug glucuronidation by the human UDP-glucuronosyltransferase 1 family. Basic Clin Pharmacol Toxicol. 2011 Dec;109(6):486-93.
19 Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
20 Deferasirox pharmacogenetic influence on pharmacokinetic, efficacy and toxicity in a cohort of pediatric patients. Pharmacogenomics. 2017 Apr;18(6):539-554.
21 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
22 Differential effects of phenobarbital on ester and ether glucuronidation of diflunisal in rats. J Pharmacol Exp Ther. 1987 Sep;242(3):1013-8.
23 Use of a human liver microsome bank in drug glucuronidation studies. Toxicol In Vitro. 1991;5(5-6):559-62.
24 Mechanisms of action, pharmacology and interactions of dolutegravir. Enferm Infecc Microbiol Clin. 2015 Mar;33 Suppl 1:2-8.
25 Eltrombopag-induced acute liver failure in a pediatric patient: a pharmacokinetic and pharmacogenetic analysis. Ther Drug Monit. 2018 Aug;40(4):386-388.
26 Elvitegravir for the treatment of HIV infection. Drugs Today (Barc). 2014 Mar;50(3):209-17.
27 Steroid glucuronides: human circulatory levels and formation by LNCaP cells. J Steroid Biochem Mol Biol. 1991;40(4-6):593-8.
28 Hepatic UDP-glucuronosyltransferase is responsible for eslicarbazepine glucuronidation. Drug Metab Dispos. 2011 Sep;39(9):1486-94.
29 Functional characterization of human and cynomolgus monkey UDP-glucuronosyltransferase 1A1 enzymes. Life Sci. 2010 Aug 14;87(7-8):261-8.
30 Stimulation of microsomal uridine diphosphate glucuronyltransferase by glucuronic acid derivatives. Biochem J. 1974 Apr;139(1):243-9.
31 Identification and preliminary characterization of UDP-glucuronosyltransferases catalyzing formation of ethyl glucuronide. Anal Bioanal Chem. 2014 Apr;406(9-10):2325-32.
32 Stereoselective glucuronidation and hydroxylation of etodolac by UGT1A9 and CYP2C9 in man. Xenobiotica. 2004 May;34(5):449-61.
33 UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for etoposide glucuronidation in human liver and intestinal microsomes: structural characterization of phenolic and alcoholic glucuronides of etoposide and estimation of enzyme kinetics. Drug Metab Dispos. 2007 Mar;35(3):371-80.
34 Ezetimibe: a review of its metabolism, pharmacokinetics and drug interactions. Clin Pharmacokinet. 2005;44(5):467-94.
35 In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition. Xenobiotica. 2008 May;38(5):496-510.
36 Predominant contribution of UDP-glucuronosyltransferase 2B7 in the glucuronidation of racemic flurbiprofen in the human liver. Drug Metab Dispos. 2007 Jul;35(7):1182-7.
37 Inactivation of the pure antiestrogen fulvestrant and other synthetic estrogen molecules by UDP-glucuronosyltransferase 1A enzymes expressed in breast tissue. Mol Pharmacol. 2006 Mar;69(3):908-20.
38 Fusidic acid inhibits hepatic transporters and metabolic enzymes: potential cause of clinical drug-drug interaction observed with statin coadministration. Antimicrob Agents Chemother. 2016 Sep 23;60(10):5986-94.
39 The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver. Drug Metab Dispos. 2007 Nov;35(11):2040-4.
40 Contribution of UDP-glucuronosyltransferases 1A9 and 2B7 to the glucuronidation of indomethacin in the human liver. Eur J Clin Pharmacol. 2007 Mar;63(3):289-96.
41 Pharmacokinetic drug interactions of morphine, codeine, and their derivatives: theory and clinical reality, Part II. Psychosomatics. 2003 Nov-Dec;44(6):515-20.
42 Is maternal opioid use hazardous to breast-fed infants? Clin Toxicol (Phila). 2012 Jan;50(1):1-14.
43 The glucuronidation of Delta4-3-Keto C19- and C21-hydroxysteroids by human liver microsomal and recombinant UDP-glucuronosyltransferases (UGTs): 6alpha- and 21-hydroxyprogesterone are selective substrates for UGT2B7. Drug Metab Dispos. 2007 Mar;35(3):363-70.
44 Use of indacaterol for the treatment of COPD: a pharmacokinetic evaluation. Expert Opin Drug Metab Toxicol. 2014 Jan;10(1):129-37.
45 Inhibition of bilirubin metabolism induces moderate hyperbilirubinemia and attenuates ANG II-dependent hypertension in mice. Am J Physiol Regul Integr Comp Physiol. 2009 Sep;297(3):R738-43.
46 Investigation into UDP-glucuronosyltransferase (UGT) enzyme kinetics of imidazole- and triazole-containing antifungal drugs in human liver microsomes and recombinant UGT enzymes. Drug Metab Dispos. 2010 Jun;38(6):923-9.
47 Association between the UGT1A1*28 allele and hyperbilirubinemia in HIV-positive patients receiving atazanavir: a meta-analysis. Biosci Rep. 2019 May 2;39(5). pii: BSR20182105.
48 Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
49 FDA Label of Liothyronine sodium. The 2020 official website of the U.S. Food and Drug Administration.
50 Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
51 A novel administration route for edaravone: I. Effects of metabolic inhibitors on skin permeability of edaravone. Int J Pharm. 2009 May 8;372(1-2):33-8.
52 Solid-phase synthesis of drug glucuronides by immobilized glucuronosyltransferase. J Med Chem. 1976 May;19(5):679-83.
53 Pharmacogenomics in drug-metabolizing enzymes catalyzing anticancer drugs for personalized cancer chemotherapy. Curr Drug Metab. 2007 Aug;8(6):554-62.
54 Human udp-glucuronosyltransferases: isoform selectivity and kinetics of 4-methylumbelliferone and 1-naphthol glucuronidation, effects of organic solvents, and inhibition by diclofenac and probenecid. Drug Metab Dispos. 2004 Apr;32(4):413-23.
55 Pharmacogenetic analysis of OATP1B1, UGT1A1, and BCRP variants in relation to the pharmacokinetics of letermovir in previously conducted clinical studies. J Clin Pharmacol. 2019 Sep;59(9):1236-1243.
56 Contribution of UDP-glucuronosyltransferase 1A1 and 1A8 to morphine-6-glucuronidation and its kinetic properties. Drug Metab Dispos. 2008 Apr;36(4):688-94.
57 Characterization of rat intestinal microsomal UDP-glucuronosyltransferase activity toward mycophenolic acid. Drug Metab Dispos. 2006 Sep;34(9):1632-9.
58 In vivo chronic exposure to heroin or naltrexone selectively inhibits liver microsome formation of estradiol-3-glucuronide in the rat. Biochem Pharmacol. 2008 Sep 1;76(5):672-9.
59 Influence of mutations associated with Gilbert and Crigler-Najjar type II syndromes on the glucuronidation kinetics of bilirubin and other UDP-glucuronosyltransferase 1A substrates. Pharmacogenet Genomics. 2007 Dec;17(12):1017-29.
60 Identification of human UDP-glucuronosyltransferase responsible for the glucuronidation of niflumic acid in human liver. Pharm Res. 2006 Jul;23(7):1502-8.
61 Evidence for oxazepam as an in vivo probe of UGT2B15: oxazepam clearance is reduced by UGT2B15 D85Y polymorphism but unaffected by UGT2B17 deletion. Br J Clin Pharmacol. 2009 Nov;68(5):721-30.
62 Identification and characterization of oxymetazoline glucuronidation in human liver microsomes: evidence for the involvement of UGT1A9. J Pharm Sci. 2011 Feb;100(2):784-93.
63 Identification of human UDP-glucuronosyltransferase isoform(s) responsible for the C-glucuronidation of phenylbutazone. Arch Biochem Biophys. 2006 Oct 1;454(1):72-9.
64 Glucuronidation of 2-arylpropionic acids pirprofen, flurbiprofen, and ibuprofen by liver microsomes. Drug Metab Dispos. 1990 Sep-Oct;18(5):692-7.
65 Metabolic fate of pitavastatin, a new inhibitor of HMG-CoA reductase: human UDP-glucuronosyltransferase enzymes involved in lactonization. Xenobiotica. 2003 Jan;33(1):27-41.
66 Identification of human UDP-glucuronosyltransferase enzyme(s) responsible for the glucuronidation of posaconazole (Noxafil). Drug Metab Dispos. 2004 Feb;32(2):267-71.
67 Modulation of 3'-azido-3'-deoxythymidine catabolism by probenecid and acetaminophen in freshly isolated rat hepatocytes. Biochem Pharmacol. 1991 Sep 12;42(7):1475-80.
68 Substrate-dependent modulation of UDP-glucuronosyltransferase 1A1 (UGT1A1) by propofol in recombinant human UGT1A1 and human liver microsomes. Basic Clin Pharmacol Toxicol. 2007 Sep;101(3):211-4.
69 Successful tacrolimus treatment following renal transplant in a HIV-infected patient with raltegravir previously treated with a protease inhibitor based regimen. Drug Metabol Drug Interact. 2011;26(3):139-41.
70 Repaglinide-gemfibrozil drug interaction: inhibition of repaglinide glucuronidation as a potential additional contributing mechanism. Br J Clin Pharmacol. 2010 Dec;70(6):870-80.
71 N-Glucuronidation of the antiepileptic drug retigabine: results from studies with human volunteers, heterologously expressed human UGTs, human liver, kidney, and liver microsomal membranes of Crigler-Najjar type II. Metabolism. 2006 Jun;55(6):711-21.
72 Human biotransformation of the nonnucleoside reverse transcriptase inhibitor rilpivirine and a cross-species metabolism comparison. Antimicrob Agents Chemother. 2013 Oct;57(10):5067-79.
73 Involvement of human CYP1A isoenzymes in the metabolism and drug interactions of riluzole in vitro. J Pharmacol Exp Ther. 1997 Sep;282(3):1465-72.
74 Functional significance of UDP-glucuronosyltransferase variants in the metabolism of active tamoxifen metabolites. Cancer Res. 2009 Mar 1;69(5):1892-900.
75 The impact of pharmacogenetics of metabolic enzymes and transporters on the pharmacokinetics of telmisartan in healthy volunteers. Pharmacogenet Genomics. 2011 Sep;21(9):523-30.
76 Actual and Predicted Pharmacokinetic Interactions Between Anticonvulsants and Antiretrovirals.
77 Role of human UGT2B10 in N-glucuronidation of tricyclic antidepressants, amitriptyline, imipramine, clomipramine, and trimipramine. Drug Metab Dispos. 2010 May;38(5):863-70.
78 Troglitazone glucuronidation in human liver and intestine microsomes: high catalytic activity of UGT1A8 and UGT1A10. Drug Metab Dispos. 2002 Dec;30(12):1462-9.
79 Effect of aging on glucuronidation of valproic acid in human liver microsomes and the role of UDP-glucuronosyltransferase UGT1A4, UGT1A8, and UGT1A10. Drug Metab Dispos. 2009 Jan;37(1):229-36.
80 A pharmacogenetic study of vorinostat glucuronidation. Pharmacogenet Genomics. 2010 Oct;20(10):638-41.
81 Assessing cytochrome P450 and UDP-glucuronosyltransferase contributions to warfarin metabolism in humans. Chem Res Toxicol. 2009 Jul;22(7):1239-45.
82 Interindividual variability in pharmacokinetics of generic nucleoside reverse transcriptase inhibitors in TB/HIV-coinfected Ghanaian patients: UGT2B7*1c is associated with faster zidovudine clearance and glucuronidation. J Clin Pharmacol. 2009 Sep;49(9):1079-90.
83 UDP-glucuronosyltransferase 2B15 (UGT2B15) and UGT2B17 enzymes are major determinants of the androgen response in prostate cancer LNCaP cells. J Biol Chem. 2007 Nov 16;282(46):33466-74.
84 Inversion of the anomeric configuration of the transferred sugar during inactivation of the macrolide antibiotic oleandomycin catalyzed by a macrolide glycosyltransferase. FEBS Lett. 2000 Jul 7;476(3):186-9.
85 Role of UDP-glucuronosyltransferase 1A1 in the metabolism and pharmacokinetics of silymarin flavonolignans in patients with HCV and NAFLD. Molecules. 2017 Jan 15;22(1). pii: E142.
86 Delafloxacin: place in therapy and review of microbiologic, clinical and pharmacologic properties. Infect Dis Ther. 2018 Jun;7(2):197-217.
87 Carisbamate addon therapy for drugresistant partial epilepsy. The Cochrane Library. John Wiley Sons, Ltd, 2016.
88 Differential and special properties of the major human UGT1-encoded gastrointestinal UDP-glucuronosyltransferases enhance potential to control chemical uptake. J Biol Chem. 2004 Jan 9;279(2):1429-41.
89 Disposition and metabolism of cabotegravir: a comparison of biotransformation and excretion between different species and routes of administration in humans. Xenobiotica. 2016;46(2):147-62.
90 Pradigastat disposition in humans: in vivo and in vitro investigations. Xenobiotica. 2017 Dec;47(12):1077-1089.
91 Characterization of the UDP glucuronosyltransferase activity of human liver microsomes genotyped for the UGT1A1*28 polymorphism. Drug Metab Dispos. 2007 Dec;35(12):2270-80.
92 FDA label of Selinexor. The 2020 official website of the U.S. Food and Drug Administration.
93 Identification of aspartic acid and histidine residues mediating the reaction mechanism and the substrate specificity of the human UDP-glucuronosyltransferases 1A. J Biol Chem. 2007 Dec 14;282(50):36514-24.
94 Preclinical discovery of candidate genes to guide pharmacogenetics during phase I development: the example of the novel anticancer agent ABT-751. Pharmacogenet Genomics. 2013 Jul;23(7):374-81.
95 Glucuronidation of active tamoxifen metabolites by the human UDP glucuronosyltransferases. Drug Metab Dispos. 2007 Nov;35(11):2006-14.
96 Paracetamol glucuronidation by recombinant rat and human phenol UDP-glucuronosyltransferases. Biochem Pharmacol. 1993 May 5;45(9):1809-14.
97 Induction and inhibition of cicletanine metabolism in cultured hepatocytes and liver microsomes from rats. Fundam Clin Pharmacol. 2000 Sep-Oct;14(5):509-18.
98 Effects of green tea compounds on irinotecan metabolism. Drug Metab Dispos. 2007 Feb;35(2):228-33.
99 Effects of UGT1A1 genotype on the pharmacokinetics, pharmacodynamics, and toxicities of belinostat administered by 48-hour continuous infusion in patients with cancer. J Clin Pharmacol. 2016 Apr;56(4):461-73.
100 Metabolism Of Antiretroviral Drugs Used In Hiv Preexposure Prophylaxis
101 In vitro inhibitory effects of non-steroidal anti-inflammatory drugs on 4-methylumbelliferone glucuronidation in recombinant human UDP-glucuronosyltransferase 1A9--potent inhibition by niflumic acid. Biopharm Drug Dispos. 2006 Jan;27(1):1-6.
102 Metabolism and excretion of capravirine, a new non-nucleoside reverse transcriptase inhibitor, alone and in combination with ritonavir in healthy volunteers. Drug Metab Dispos. 2004 Jul;32(7):689-98.
103 Bictegravir, a novel integrase inhibitor for the treatment of HIV infection. Drugs Today (Barc). 2019 Nov;55(11):669-682.
104 Phase I clinical and pharmacogenetic study of weekly TAS-103 in patients with advanced cancer. J Clin Oncol. 2001 Apr 1;19(7):2084-90.
105 Inhibition of UDP-glucuronyltransferase activity in rat liver microsomes by pyrimidine derivatives. Comp Biochem Physiol C Pharmacol Toxicol Endocrinol. 1995 Nov;112(3):321-5.