Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEYGVN4)

DME Name	UDP-glucuronosyltransferase 1A1 (UGT1A1)
Synonyms	UDP-glucuronosyltransferase family 1 member A1; UDP-glucuronosyltransferase 1-A; UDP-glucuronosyltransferase 1-1; Bilirubin-specific UDPGT isozyme 1; UDPGT 1-1; UGT-1A; GNT1; UGT1; UGT1*1; UGT1-01; UGT1.1; UGT1A; UGT1A1; hUG-BR1
Gene Name	UGT1A1
UniProt ID	UD11_HUMAN
INTEDE ID	DME0004
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	54658
EC Number	EC: 2.4.1.17 Transferase Glycosyltransferases Hexosyltransferase EC: 2.4.1.17
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVL APDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDS AMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLE FEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQR EVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH GIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDL LGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD LTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Function	This enzyme catalyzes the glucuronidation of 17beta-estradiol, 17alpha-ethinylestradiol, 1-hydroxypyrene, 4-methylumbelliferone, 1-naphthol, paranitrophenol, scopoletin, and umbelliferone.
KEGG Pathway	Ascorbate and aldarate metabolism (hsa00053 ) Chemical carcinogenesis (hsa05204 ) Drug metabolism - cytochrome P450 (hsa00982 ) Drug metabolism - other enzymes (hsa00983 ) Metabolic pathways (hsa01100 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Pentose and glucuronate interconversions (hsa00040 ) Porphyrin and chlorophyll metabolism (hsa00860 ) Retinol metabolism (hsa00830 ) Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway	Glucuronidation (R-HSA-156588 ) Defective UGT1A1 causes hyperbilirubinemia (R-HSA-5579002 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

102 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Abacavir	DMMN36E	Human immunodeficiency virus infection	1C62	Approved	[2]
Acetaminophen	DMUIE76	Allergic rhinitis	CA08.0	Approved	[3]
Amitriptyline	DMK7F9S	Depression	6A70-6A7Z	Approved	[4]
Anastrozole	DMNP60F	Breast cancer	2C60-2C65	Approved	[5]
ARRY-162	DM1P6FR	Melanoma	2C30	Approved	[6]
Aspirin	DM672AH	Acute coronary syndrome	BA41	Approved	[7]
Atazanavir	DMSYRBX	Human immunodeficiency virus infection	1C62	Approved	[8]
Atorvastatin	DMF28YC	Acute coronary syndrome	BA41	Approved	[9]
Axitinib	DMGVH6N	Renal cell carcinoma	2C90	Approved	[10]
Bazedoxifene	DMY85QW	Hot flushes	GA30	Approved	[11]
Buprenorphine	DMPRI8G	Opioid dependence	6C43.2Z	Approved	[12]
Candesartan	DMRK8OT	Chronic heart failure	BD1Z	Approved	[13]
Carvedilol	DMHTEAO	Chronic heart failure	BD1Z	Approved	[14]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[15]
Chenodiol	DMQ8JIK	Cholelithiasis	DC11	Approved	[16]
Codeine	DMJX6ZG	Allergic rhinitis	CA08.0	Approved	[17]
Cyproheptadine	DM92AH3	Allergic rhinitis	CA08.0	Approved	[18]
Darolutamide	DMV7YFT	Prostate cancer	2C82.0	Approved	[19]
Deferasirox	DM6ETS0	Beta thalassemia	3A50.2	Approved	[20]
Dexibuprofen	DMFYBD0	Ankylosing spondylitis	FA92.0	Approved	[21]
Diflunisal	DM7EN8I	Osteoarthritis	FA00-FA05	Approved	[22]
Digitoxin	DMWVIGP	Arrhythmia	BC9Z	Approved	[23]
Dolutegravir	DMCZGRE	Human immunodeficiency virus infection	1C62	Approved	[24]
Eltrombopag	DMOGFIX	Thrombocytopenia	3B64	Approved	[25]
Elvitegravir	DMG9B1U	Human immunodeficiency virus infection	1C62	Approved	[26]
Epinephrine	DM3KJBC	Acute asthma	CA23	Approved	[27]
Eslicarbazepine	DMZREFQ	Seizure disorder	8A6Z	Approved	[28]
Estradiol	DMUNTE3	Acne vulgaris	ED80	Approved	[29]
Estradiol Acetate	DM07U2A	Hormone replacement therapy	8E01	Approved	[29]
Estradiol Cypionate	DM27Z5T	Hormone replacement therapy	8E01	Approved	[29]
Estradiol Valerate	DM8MC6O	Hormone replacement therapy	8E01	Approved	[29]
Estriol	DMOEM2I	Hormone deficiency	5A61.1	Approved	[30]
Ethanol	DMDRQZU	Chronic pain	MG30	Approved	[31]
Ethinyl Estradiol	DMODJ40	Acne vulgaris	ED80	Approved	[14]
Etodolac	DM6WJO9	Osteoarthritis	FA00-FA05	Approved	[32]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[33]
Ezetimibe	DM7A8TW	Atherosclerosis	BD40	Approved	[34]
Febuxostat	DMDEXQ0	Hyperuricaemia	5C55.Y	Approved	[35]
Flurbiprofen	DMGN4BY	Osteoarthritis	FA00-FA05	Approved	[36]
Fulvestrant	DM0YZC6	Breast cancer	2C60-2C65	Approved	[37]
Furosemide	DMMQ8ZG	Congestive heart failure	BD10	Approved	[14]
Fusidic Acid	DMWVCF3	Acne vulgaris	ED80	Approved	[38]
Gemfibrozil	DMD8Q3J	Hyperlipidaemia	5C80	Approved	[39]
Glibenclamide	DM8JXPZ	Diabetic complication	5A2Y	Approved	[40]
Glipizide	DMZA5PQ	Diabetic complication	5A2Y	Approved	[14]
Hydrocodone bitartrate	DMIAPBE	N. A.	N. A.	Approved	[41]
Hydromorphone	DMHP21E	Back pain	ME84.Z	Approved	[42]
Hydroxyprogesterone	DMIKQH5	Solid tumour/cancer	2A00-2F9Z	Approved	[43]
Imipramine	DM2NUH3	Depression	6A70-6A7Z	Approved	[4]
Indacaterol	DMQJHR7	Chronic obstructive pulmonary disease	CA22	Approved	[44]
Indinavir	DM0T3YH	Human immunodeficiency virus infection	1C62	Approved	[45]
Indomethacin	DMSC4A7	Bursitis		Approved	[21]
Itraconazole	DMCR1MV	Aspergillosis	1F20	Approved	[46]
Ketoprofen	DMRKXPT	Bursitis		Approved	[47]
Labetalol	DMK8U72	Hypertension	BA00-BA04	Approved	[48]
Lamotrigine	DM8SXYG	Bipolar disorder	6A60	Approved	[14]
Levothyroxine	DMHN027	Congenital hypothyroidism		Approved	[14]
Liothyronine	DM6IR3P	Congenital hypothyroidism		Approved	[49]
Losartan	DM72JXH	Diabetic kidney disease	GB61.Z	Approved	[13]
Lovastatin	DM9OZWQ	Arteriosclerosis	BD40	Approved	[50]
MCI-186	DM8ZHP1	Amyotrophic lateral sclerosis	8B60.0	Approved	[51]
Meprobamate	DMHM93Y	Anxiety		Approved	[52]
Mercaptopurine	DMTM2IK	Acute lymphoblastic leukaemia	2A85	Approved	[53]
Metronidazole	DMTIVEN	Abscess		Approved	[14]
Minoxidil	DMA2Z4F	Alopecia	ED70	Approved	[54]
MK-8228	DMOB58Q	Cytomegalovirus Disease	1D82	Approved	[55]
Morphine	DMRMS0L	Advanced cancer	2A00-2F9Z	Approved	[56]
Mycophenolate mofetil	DMPQAGE	Hepatosplenic T-cell lymphoma		Approved	[57]
Naltrexone	DMUL45H	Alcohol dependence	6C40.2	Approved	[58]
Naproxen	DMZ5RGV	Bursitis		Approved	[59]
Nicotine	DMWX5CO	Lung cancer	2C25.0	Approved	[4]
Niflumic Acid	DMJ3I1Q	Rheumatoid arthritis	FA20	Approved	[60]
Oxazepam	DMXNZM4	Alcohol withdrawal delirium		Approved	[61]
Oxymetazoline	DM8ZXT6	Arrhythmia	BC9Z	Approved	[62]
Phenylbutazone	DMAYL0T	Chronic pain	MG30	Approved	[63]
Pirprofen	DMMOFHT	Dysmenorrhea	GA34.3	Approved	[64]
PITAVASTATIN CALCIUM	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[65]
Posaconazole	DMUL5EW	Aspergillosis	1F20	Approved	[66]
Probenecid	DMMFWOJ	Acute gonococcal cervicitis		Approved	[67]
Propofol	DMB4OLE	Anaesthesia	9A78.6	Approved	[68]
Raloxifene	DMDKF3M	Osteoporosis	FB83.0	Approved	[14]
Raltegravir	DMYURI6	Human immunodeficiency virus infection	1C62	Approved	[69]
Repaglinide	DM5SXUV	Diabetic complication	5A2Y	Approved	[70]
Retigabine	DMGNYIH	Behcet disease	4A62	Approved	[71]
Rilpivirine	DMJ0QOW	Human immunodeficiency virus infection	1C62	Approved	[72]
Riluzole	DMECBWN	Amyotrophic lateral sclerosis	8B60.0	Approved	[73]
Simvastatin	DM30SGU	Arteriosclerosis	BD40	Approved	[50]
Suprofen	DMKXJZ7	Miosis	LA11.62	Approved	[21]
Tamoxifen	DMLB0EZ	Breast cancer	2C60-2C65	Approved	[74]
Telmisartan	DMS3GX2	Hypertension	BA00-BA04	Approved	[75]
Tiagabine	DMKSQG0	Epilepsy	8A60-8A68	Approved	[76]
Tramadol	DMRQD04	Osteoarthritis	FA00-FA05	Approved	[14]
Trimipramine	DM1SC8M	Major depressive disorder	6A70.3	Approved	[77]
Troglitazone	DM3VFPD	Diabetic complication	5A2Y	Approved	[78]
Valproate	DMCFE9I	Epilepsy	8A60-8A68	Approved	[79]
Vorinostat	DMWMPD4	Adult acute monocytic leukemia		Approved	[80]
Warfarin	DMJYCVW	Atrial fibrillation	BC81.3	Approved	[81]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[82]
Zonisamide	DM0DTF7	Alcohol dependence	6C40.2	Approved	[76]
Dihydrotestosterone	DM3S8XC	Prostate hyperplasia	GA90	Phase 4	[83]
Oleandomycin	DMVAOME	N. A.	N. A.	Phase 4	[84]
Silymarin	DMXBYQR	N. A.	N. A.	Phase 4	[85]
------------------------------------------------------------------------------------


⏷ Show the Full List of 102 Approved Drug(s)

20 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-492	DMJFD2I	Bacterial infection	1A00-1C4Z	Phase 3	[86]
Carisbamate	DM4Y1SP	Epilepsy	8A60-8A68	Phase 3	[87]
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[88]
GSK1265744	DMT8J0I	Human immunodeficiency virus infection	1C62	Phase 3	[89]
LCQ908	DMFLJHQ	Familial chylomicronemia syndrome	5C80	Phase 3	[90]
MURAGLITAZAR	DMG3NFZ	N. A.	N. A.	Phase 3	[91]
Selinexor	DMBD4K3	Multiple myeloma	2A83	Phase 3	[92]
PHENOL	DM1QSM3	N. A.	N. A.	Phase 2/3	[93]
ABT-751	DMNG35S	Solid tumour/cancer	2A00-2F9Z	Phase 2	[94]
Afimoxifene	DMFORDT	Breast cancer	2C60-2C65	Phase 2	[95]
BCP-13498	DM2BO9W	N. A.	N. A.	Phase 2	[96]
Cicletanine	DMGTZLW	Pulmonary arterial hypertension	BB01.0	Phase 2	[97]
Flavopiridol	DMKSUOI	Acute myeloid leukaemia	2A60	Phase 2	[14]
LE-SN38	DMW50NF	Colorectal cancer	2B91.Z	Phase 2	[98]
PDX-101	DM6OC53	Plasma cell myeloma	2A83.1	Phase 2	[99]
Dapivirine	DMJPSIL	Human immunodeficiency virus infection	1C62	Phase 1/2	[100]
LM-94	DMW3QGJ	N. A.	N. A.	Phase 1/2	[101]
Capravirine	DM9ERH1	Human immunodeficiency virus infection	1C62	Phase 1	[102]
GS-9883	DMMF5IE	N. A.	N. A.	Phase 1	[103]
TAS-103	DM5WDKY	Solid tumour/cancer	2A00-2F9Z	Phase 1	[104]
------------------------------------------------------------------------------------


⏷ Show the Full List of 20 Clinical Trial Drug(s)

1 Patented Agent(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
EUGENOL	DM7US1H	Discovery agent	N.A.	Patented	[88]
------------------------------------------------------------------------------------

3 Discontinued Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Phenolphthalein	DM5SICT	Constipation	DD91.1	Withdrawn from market	[105]
Gavestinel	DM8IL1U	Nerve injury	ND56.4	Discontinued in Phase 2	[21]
VR-776	DMFQWNI	Premature ejaculation	HA03.0Z	Discontinued in Phase 1	[77]
------------------------------------------------------------------------------------

5 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ACMC-1AKLT	DMRQ70X	N. A.	N. A.	Investigative	[29]
Anthraflavic acid	DMN1YFU	N. A.	N. A.	Investigative	[88]
Chrysin	DM7V2LG	Discovery agent	N.A.	Investigative	[88]
Cis-4-hydroxytamoxifen	DMRFTB5	N. A.	N. A.	Investigative	[95]
phloretin	DMYA50U	Discovery agent	N.A.	Investigative	[88]
------------------------------------------------------------------------------------

Experimental Enzyme Kinetic Data of Drugs

Drug Name	Indication	Highest Status	Kinetic Data	REF
Chrysin	Discovery agent [N.A.]	Investigative	Km = 0.004 microM	[88]
phloretin	Discovery agent [N.A.]	Investigative	Km = 0.0068 microM	[88]
EUGENOL	Discovery agent [N.A.]	Patented	Km = 0.0084 microM	[88]
Afimoxifene	Breast cancer [2C60-2C65]	Phase 2	Km = 0.004 microM	[95]
Curcumin	Solid tumour/cancer [2A00-2F9Z]	Phase 3	Km = 0.1 microM	[88]
Ethanol	Chronic pain [MG30]	Approved	Km = 8.03 microM	[31]


⏷ Show the Full List of 6 Drugs with Enzyme Kinetic Data

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	4.83E-07	8.08E-02	4.11E-01
Alopecia	ED70	Skin from scalp	1.46E-01	-1.86E-02	-8.11E-02
Alzheimer's disease	8A20	Entorhinal cortex	1.10E-01	-5.91E-02	-3.60E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	1.69E-01	9.30E-02	7.05E-01
Aortic stenosis	BB70	Calcified aortic valve	1.84E-01	2.05E-01	8.91E-01
Apnea	7A40	Hyperplastic tonsil	3.44E-01	-2.67E-02	-1.48E-01
Arthropathy	FA00-FA5Z	Peripheral blood	9.48E-01	-8.54E-03	-6.13E-02
Asthma	CA23	Nasal and bronchial airway	3.80E-01	-9.11E-03	-3.47E-02
Atopic dermatitis	EA80	Skin	3.37E-04	-1.50E-01	-9.69E-01
Autism	6A02	Whole blood	2.69E-01	4.90E-02	1.88E-01
Autoimmune uveitis	9A96	Peripheral monocyte	6.04E-02	-2.20E-01	-1.16E+00
Autosomal dominant monocytopenia	4B04	Whole blood	5.60E-01	-5.65E-02	-4.75E-01
Bacterial infection of gingival	1C1H	Gingival tissue	5.17E-01	6.55E-02	2.04E-01
Batten disease	5C56.1	Whole blood	9.21E-01	-5.04E-02	-4.11E-01
Behcet's disease	4A62	Peripheral blood	6.15E-01	2.28E-02	1.18E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	2.03E-01	8.52E-02	6.41E-01
Bladder cancer	2C94	Bladder tissue	3.76E-02	9.81E-02	4.02E-01
Breast cancer	2C60-2C6Z	Breast tissue	6.74E-01	-1.44E-02	-7.35E-02
Cardioembolic stroke	8B11.20	Whole blood	2.22E-04	2.15E-01	1.22E+00
Cervical cancer	2C77	Cervical tissue	2.40E-01	-7.00E-02	-3.69E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	7.37E-01	-3.42E-02	-1.12E-01
Chronic hepatitis C	1E51.1	Whole blood	9.82E-01	1.47E-02	6.84E-02
Chronic obstructive pulmonary disease	CA22	Lung tissue	8.29E-01	-5.44E-03	-2.25E-02
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	4.23E-03	9.31E-02	4.30E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	6.93E-01	1.04E-02	8.52E-02
Colon cancer	2B90	Colon tissue	3.70E-05	-8.48E-02	-3.30E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	3.89E-01	-6.89E-02	-2.01E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	3.08E-01	7.98E-03	3.57E-02
Endometriosis	GA10	Endometrium tissue	1.98E-01	1.01E-01	3.33E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	2.10E-01	1.41E-01	6.42E-01
Familial hypercholesterolemia	5C80.00	Whole blood	2.00E-01	5.79E-02	3.00E-01
Gastric cancer	2B72	Gastric tissue	7.39E-02	3.09E-01	2.24E+00
Glioblastopma	2A00.00	Nervous tissue	6.50E-01	1.30E-02	5.24E-02
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	7.13E-01	-6.34E-02	-5.97E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	3.04E-04	-5.18E-01	-1.68E+00
Head and neck cancer	2D42	Head and neck tissue	1.04E-03	-7.68E-02	-3.85E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	5.34E-02	-7.88E-02	-1.98E-01
Huntington's disease	8A01.10	Whole blood	8.92E-01	-9.30E-02	-6.37E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	7.59E-01	8.21E-02	5.64E-01
Immunodeficiency	4A00-4A20	Peripheral blood	2.34E-01	1.78E-02	1.52E-01
Influenza	1E30	Whole blood	1.24E-02	4.20E-01	3.84E+00
Interstitial cystitis	GC00.3	Bladder tissue	2.00E-02	1.81E-01	1.77E+00
Intracranial aneurysm	8B01.0	Intracranial artery	3.06E-01	-3.90E-02	-1.78E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	4.40E-01	-4.85E-04	-1.69E-03
Ischemic stroke	8B11	Peripheral blood	2.61E-01	-6.03E-02	-2.74E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	3.30E-01	-2.46E-02	-9.42E-02
Lateral sclerosis	8B60.4	Skin	6.40E-01	3.70E-02	1.48E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	5.01E-01	1.93E-01	4.52E-01
Liver cancer	2C12.0	Liver tissue	6.94E-01	1.98E-02	9.45E-02
Liver failure	DB99.7-DB99.8	Liver tissue	9.52E-01	-4.37E-02	-2.04E-01
Lung cancer	2C25	Lung tissue	2.33E-02	1.75E-02	8.91E-02
Lupus erythematosus	4A40	Whole blood	2.19E-02	-3.33E-02	-7.37E-02
Major depressive disorder	6A70-6A7Z	Hippocampus	1.87E-01	4.98E-02	3.61E-01
Major depressive disorder	6A70-6A7Z	Whole blood	9.17E-02	4.08E-02	1.59E-01
Melanoma	2C30	Skin	8.43E-01	1.95E-02	3.86E-02
Multiple myeloma	2A83.1	Peripheral blood	6.60E-01	2.51E-02	8.26E-02
Multiple myeloma	2A83.1	Bone marrow	8.62E-03	1.37E-01	8.67E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	7.69E-01	1.91E-02	5.45E-02
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	7.18E-01	4.62E-02	2.36E-01
Myelofibrosis	2A20.2	Whole blood	8.65E-03	-6.65E-02	-4.13E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.86E-01	5.00E-02	1.43E-01
Myopathy	8C70.6	Muscle tissue	5.94E-01	-1.29E-01	-8.90E-01
Neonatal sepsis	KA60	Whole blood	5.66E-04	-4.90E-02	-1.83E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	6.49E-01	7.94E-02	3.42E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	4.43E-01	-1.85E-02	-1.25E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	5.78E-01	-1.53E-02	-3.93E-01
Olive pollen allergy	CA08.00	Peripheral blood	6.85E-01	-4.31E-02	-2.18E-01
Oral cancer	2B6E	Oral tissue	5.98E-01	-5.34E-02	-2.12E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	4.11E-01	5.03E-03	2.97E-02
Osteoporosis	FB83.1	Bone marrow	4.43E-01	4.28E-02	2.46E-01
Ovarian cancer	2C73	Ovarian tissue	7.11E-01	1.85E-01	5.52E-01
Pancreatic cancer	2C10	Pancreas	2.45E-01	-1.66E-01	-4.71E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	4.53E-01	4.14E-02	1.83E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	1.49E-02	-1.03E-01	-7.62E-01
Pituitary cancer	2D12	Pituitary tissue	1.83E-03	2.27E-01	1.62E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	8.42E-02	7.93E-02	4.07E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	9.39E-01	4.04E-02	1.42E-01
Polycythemia vera	2A20.4	Whole blood	1.23E-01	-4.00E-02	-2.26E-01
Pompe disease	5C51.3	Biceps muscle	4.05E-01	-1.01E-01	-5.06E-01
Preterm birth	KA21.4Z	Myometrium	2.91E-01	7.62E-02	6.08E-01
Prostate cancer	2C82	Prostate	2.60E-03	3.86E-01	8.02E-01
Psoriasis	EA90	Skin	9.29E-06	-4.82E-01	-7.82E-01
Rectal cancer	2B92	Rectal colon tissue	1.87E-02	-4.28E-01	-1.94E+00
Renal cancer	2C90-2C91	Kidney	2.57E-01	8.93E-02	5.68E-01
Retinoblastoma	2D02.2	Uvea	3.14E-02	-1.16E-01	-6.08E-01
Rheumatoid arthritis	FA20	Synovial tissue	9.12E-01	2.06E-01	3.41E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	5.08E-01	-3.22E-02	-3.06E-01
Schizophrenia	6A20	Prefrontal cortex	8.03E-01	9.92E-03	4.89E-02
Schizophrenia	6A20	Superior temporal cortex	1.42E-01	-4.97E-02	-3.73E-01
Scleroderma	4A42.Z	Whole blood	7.26E-09	3.41E-01	4.05E+00
Seizure	8A60-8A6Z	Whole blood	3.23E-01	-3.50E-02	-1.96E-01
Sensitive skin	EK0Z	Skin	5.34E-01	-2.43E-02	-1.99E-01
Sepsis with septic shock	1G41	Whole blood	1.46E-01	6.14E-02	1.89E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	3.66E-01	-1.22E-01	-3.85E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	5.29E-02	2.26E-01	1.23E+00
Simpson golabi behmel syndrome	LD2C	Adipose tissue	3.03E-02	1.31E-01	1.81E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	4.19E-01	-2.73E-01	-1.01E+00
Skin cancer	2C30-2C3Z	Skin	3.45E-18	-3.01E-01	-4.74E-01
Thrombocythemia	3B63	Whole blood	4.03E-01	2.82E-02	1.62E-01
Thrombocytopenia	3B64	Whole blood	5.31E-01	7.20E-02	4.31E-01
Thyroid cancer	2D10	Thyroid	5.73E-01	-2.96E-02	-1.22E-01
Tibial muscular dystrophy	8C75	Muscle tissue	6.96E-03	-1.95E-01	-8.72E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	9.43E-01	1.22E-01	3.50E-01
Type 2 diabetes	5A11	Liver tissue	5.20E-01	-3.27E-03	-2.84E-02
Ureter cancer	2C92	Urothelium	3.59E-01	-3.65E-02	-1.61E-01
Uterine cancer	2C78	Endometrium tissue	1.33E-18	2.66E-01	1.10E+00
Vitiligo	ED63.0	Skin	3.47E-01	-1.58E-02	-6.45E-02
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

UDP-glucuronosyltransferase 1A1 (UGT1A1) DTT Info

DME DTT Type

Clinical trial

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AT-342	DMSOQ6E	Crigler-Najjar syndrome	5C58.00	Phase 1/2	[1]
------------------------------------------------------------------------------------

References

1	ClinicalTrials.gov (NCT03223194) Gene Transfer Clinical Study in Crigler-Najjar Syndrome (VALENS). U.S. National Institutes of Health.
2	A review of the pharmacokinetics of abacavir. Clin Pharmacokinet. 2008;47(6):351-71.
3	Effect of UDP-glucuronosyltransferase (UGT) 1A polymorphism (rs8330 and rs10929303) on glucuronidation status of acetaminophen. Dose Response. 2017 Sep 11;15(3):1559325817723731.
4	Liquid chromatography-tandem mass spectrometry method for measurement of nicotine N-glucuronide: a marker for human UGT2B10 inhibition. J Pharm Biomed Anal. 2011 Jul 15;55(5):964-71.
5	In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
6	Binimetinib - European Medicines Agency - European Union
7	Pharmacogenomics in aspirin intolerance. Curr Drug Metab. 2009 Nov;10(9):998-1008.
8	In vitro inhibition of UDP glucuronosyltransferases by atazanavir and other HIV protease inhibitors and the relationship of this property to in vivo bilirubin glucuronidation. Drug Metab Dispos. 2005 Nov;33(11):1729-39.
9	Atorvastatin glucuronidation is minimally and nonselectively inhibited by the fibrates gemfibrozil, fenofibrate, and fenofibric acid. Drug Metab Dispos. 2007 Aug;35(8):1315-24.
10	Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
11	UGT1A1*28 polymorphism influences glucuronidation of bazedoxifene. Pharmazie. 2015 Feb;70(2):94-6.
12	Contribution of the different UDP-glucuronosyltransferase (UGT) isoforms to buprenorphine and norbuprenorphine metabolism and relationship with the main UGT polymorphisms in a bank of human liver microsomes. Drug Metab Dispos. 2010 Jan;38(1):40-5.
13	The human UDP-glucuronosyltransferase UGT1A3 is highly selective towards N2 in the tetrazole ring of losartan, candesartan, and zolarsartan. Biochem Pharmacol. 2008 Sep 15;76(6):763-72.
14	Drug-drug interactions for UDP-glucuronosyltransferase substrates: a pharmacokinetic explanation for typically observed low exposure (AUCi/AUC) ratios. Drug Metab Dispos. 2004 Nov;32(11):1201-8.
15	Cerivastatin, genetic variants, and the risk of rhabdomyolysis. Pharmacogenet Genomics. 2011 May;21(5):280-8.
16	Human UDP-glucuronosyltransferase (UGT)1A3 enzyme conjugates chenodeoxycholic acid in the liver. Hepatology. 2006 Nov;44(5):1158-70.
17	Evaluation of 3'-azido-3'-deoxythymidine, morphine, and codeine as probe substrates for UDP-glucuronosyltransferase 2B7 (UGT2B7) in human liver microsomes: specificity and influence of the UGT2B7*2 polymorphism. Drug Metab Dispos. 2003 Sep;31(9):1125-33.
18	Effect of common exon variant (p.P364L) on drug glucuronidation by the human UDP-glucuronosyltransferase 1 family. Basic Clin Pharmacol Toxicol. 2011 Dec;109(6):486-93.
19	Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
20	Deferasirox pharmacogenetic influence on pharmacokinetic, efficacy and toxicity in a cohort of pediatric patients. Pharmacogenomics. 2017 Apr;18(6):539-554.
21	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
22	Differential effects of phenobarbital on ester and ether glucuronidation of diflunisal in rats. J Pharmacol Exp Ther. 1987 Sep;242(3):1013-8.
23	Use of a human liver microsome bank in drug glucuronidation studies. Toxicol In Vitro. 1991;5(5-6):559-62.
24	Mechanisms of action, pharmacology and interactions of dolutegravir. Enferm Infecc Microbiol Clin. 2015 Mar;33 Suppl 1:2-8.
25	Eltrombopag-induced acute liver failure in a pediatric patient: a pharmacokinetic and pharmacogenetic analysis. Ther Drug Monit. 2018 Aug;40(4):386-388.
26	Elvitegravir for the treatment of HIV infection. Drugs Today (Barc). 2014 Mar;50(3):209-17.
27	Steroid glucuronides: human circulatory levels and formation by LNCaP cells. J Steroid Biochem Mol Biol. 1991;40(4-6):593-8.
28	Hepatic UDP-glucuronosyltransferase is responsible for eslicarbazepine glucuronidation. Drug Metab Dispos. 2011 Sep;39(9):1486-94.
29	Functional characterization of human and cynomolgus monkey UDP-glucuronosyltransferase 1A1 enzymes. Life Sci. 2010 Aug 14;87(7-8):261-8.
30	Stimulation of microsomal uridine diphosphate glucuronyltransferase by glucuronic acid derivatives. Biochem J. 1974 Apr;139(1):243-9.
31	Identification and preliminary characterization of UDP-glucuronosyltransferases catalyzing formation of ethyl glucuronide. Anal Bioanal Chem. 2014 Apr;406(9-10):2325-32.
32	Stereoselective glucuronidation and hydroxylation of etodolac by UGT1A9 and CYP2C9 in man. Xenobiotica. 2004 May;34(5):449-61.
33	UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for etoposide glucuronidation in human liver and intestinal microsomes: structural characterization of phenolic and alcoholic glucuronides of etoposide and estimation of enzyme kinetics. Drug Metab Dispos. 2007 Mar;35(3):371-80.
34	Ezetimibe: a review of its metabolism, pharmacokinetics and drug interactions. Clin Pharmacokinet. 2005;44(5):467-94.
35	In vitro drug-drug interaction studies with febuxostat, a novel non-purine selective inhibitor of xanthine oxidase: plasma protein binding, identification of metabolic enzymes and cytochrome P450 inhibition. Xenobiotica. 2008 May;38(5):496-510.
36	Predominant contribution of UDP-glucuronosyltransferase 2B7 in the glucuronidation of racemic flurbiprofen in the human liver. Drug Metab Dispos. 2007 Jul;35(7):1182-7.
37	Inactivation of the pure antiestrogen fulvestrant and other synthetic estrogen molecules by UDP-glucuronosyltransferase 1A enzymes expressed in breast tissue. Mol Pharmacol. 2006 Mar;69(3):908-20.
38	Fusidic acid inhibits hepatic transporters and metabolic enzymes: potential cause of clinical drug-drug interaction observed with statin coadministration. Antimicrob Agents Chemother. 2016 Sep 23;60(10):5986-94.
39	The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver. Drug Metab Dispos. 2007 Nov;35(11):2040-4.
40	Contribution of UDP-glucuronosyltransferases 1A9 and 2B7 to the glucuronidation of indomethacin in the human liver. Eur J Clin Pharmacol. 2007 Mar;63(3):289-96.
41	Pharmacokinetic drug interactions of morphine, codeine, and their derivatives: theory and clinical reality, Part II. Psychosomatics. 2003 Nov-Dec;44(6):515-20.
42	Is maternal opioid use hazardous to breast-fed infants? Clin Toxicol (Phila). 2012 Jan;50(1):1-14.
43	The glucuronidation of Delta4-3-Keto C19- and C21-hydroxysteroids by human liver microsomal and recombinant UDP-glucuronosyltransferases (UGTs): 6alpha- and 21-hydroxyprogesterone are selective substrates for UGT2B7. Drug Metab Dispos. 2007 Mar;35(3):363-70.
44	Use of indacaterol for the treatment of COPD: a pharmacokinetic evaluation. Expert Opin Drug Metab Toxicol. 2014 Jan;10(1):129-37.
45	Inhibition of bilirubin metabolism induces moderate hyperbilirubinemia and attenuates ANG II-dependent hypertension in mice. Am J Physiol Regul Integr Comp Physiol. 2009 Sep;297(3):R738-43.
46	Investigation into UDP-glucuronosyltransferase (UGT) enzyme kinetics of imidazole- and triazole-containing antifungal drugs in human liver microsomes and recombinant UGT enzymes. Drug Metab Dispos. 2010 Jun;38(6):923-9.
47	Association between the UGT1A1*28 allele and hyperbilirubinemia in HIV-positive patients receiving atazanavir: a meta-analysis. Biosci Rep. 2019 May 2;39(5). pii: BSR20182105.
48	Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
49	FDA Label of Liothyronine sodium. The 2020 official website of the U.S. Food and Drug Administration.
50	Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
51	A novel administration route for edaravone: I. Effects of metabolic inhibitors on skin permeability of edaravone. Int J Pharm. 2009 May 8;372(1-2):33-8.
52	Solid-phase synthesis of drug glucuronides by immobilized glucuronosyltransferase. J Med Chem. 1976 May;19(5):679-83.
53	Pharmacogenomics in drug-metabolizing enzymes catalyzing anticancer drugs for personalized cancer chemotherapy. Curr Drug Metab. 2007 Aug;8(6):554-62.
54	Human udp-glucuronosyltransferases: isoform selectivity and kinetics of 4-methylumbelliferone and 1-naphthol glucuronidation, effects of organic solvents, and inhibition by diclofenac and probenecid. Drug Metab Dispos. 2004 Apr;32(4):413-23.
55	Pharmacogenetic analysis of OATP1B1, UGT1A1, and BCRP variants in relation to the pharmacokinetics of letermovir in previously conducted clinical studies. J Clin Pharmacol. 2019 Sep;59(9):1236-1243.
56	Contribution of UDP-glucuronosyltransferase 1A1 and 1A8 to morphine-6-glucuronidation and its kinetic properties. Drug Metab Dispos. 2008 Apr;36(4):688-94.
57	Characterization of rat intestinal microsomal UDP-glucuronosyltransferase activity toward mycophenolic acid. Drug Metab Dispos. 2006 Sep;34(9):1632-9.
58	In vivo chronic exposure to heroin or naltrexone selectively inhibits liver microsome formation of estradiol-3-glucuronide in the rat. Biochem Pharmacol. 2008 Sep 1;76(5):672-9.
59	Influence of mutations associated with Gilbert and Crigler-Najjar type II syndromes on the glucuronidation kinetics of bilirubin and other UDP-glucuronosyltransferase 1A substrates. Pharmacogenet Genomics. 2007 Dec;17(12):1017-29.
60	Identification of human UDP-glucuronosyltransferase responsible for the glucuronidation of niflumic acid in human liver. Pharm Res. 2006 Jul;23(7):1502-8.
61	Evidence for oxazepam as an in vivo probe of UGT2B15: oxazepam clearance is reduced by UGT2B15 D85Y polymorphism but unaffected by UGT2B17 deletion. Br J Clin Pharmacol. 2009 Nov;68(5):721-30.
62	Identification and characterization of oxymetazoline glucuronidation in human liver microsomes: evidence for the involvement of UGT1A9. J Pharm Sci. 2011 Feb;100(2):784-93.
63	Identification of human UDP-glucuronosyltransferase isoform(s) responsible for the C-glucuronidation of phenylbutazone. Arch Biochem Biophys. 2006 Oct 1;454(1):72-9.
64	Glucuronidation of 2-arylpropionic acids pirprofen, flurbiprofen, and ibuprofen by liver microsomes. Drug Metab Dispos. 1990 Sep-Oct;18(5):692-7.
65	Metabolic fate of pitavastatin, a new inhibitor of HMG-CoA reductase: human UDP-glucuronosyltransferase enzymes involved in lactonization. Xenobiotica. 2003 Jan;33(1):27-41.
66	Identification of human UDP-glucuronosyltransferase enzyme(s) responsible for the glucuronidation of posaconazole (Noxafil). Drug Metab Dispos. 2004 Feb;32(2):267-71.
67	Modulation of 3'-azido-3'-deoxythymidine catabolism by probenecid and acetaminophen in freshly isolated rat hepatocytes. Biochem Pharmacol. 1991 Sep 12;42(7):1475-80.
68	Substrate-dependent modulation of UDP-glucuronosyltransferase 1A1 (UGT1A1) by propofol in recombinant human UGT1A1 and human liver microsomes. Basic Clin Pharmacol Toxicol. 2007 Sep;101(3):211-4.
69	Successful tacrolimus treatment following renal transplant in a HIV-infected patient with raltegravir previously treated with a protease inhibitor based regimen. Drug Metabol Drug Interact. 2011;26(3):139-41.
70	Repaglinide-gemfibrozil drug interaction: inhibition of repaglinide glucuronidation as a potential additional contributing mechanism. Br J Clin Pharmacol. 2010 Dec;70(6):870-80.
71	N-Glucuronidation of the antiepileptic drug retigabine: results from studies with human volunteers, heterologously expressed human UGTs, human liver, kidney, and liver microsomal membranes of Crigler-Najjar type II. Metabolism. 2006 Jun;55(6):711-21.
72	Human biotransformation of the nonnucleoside reverse transcriptase inhibitor rilpivirine and a cross-species metabolism comparison. Antimicrob Agents Chemother. 2013 Oct;57(10):5067-79.
73	Involvement of human CYP1A isoenzymes in the metabolism and drug interactions of riluzole in vitro. J Pharmacol Exp Ther. 1997 Sep;282(3):1465-72.
74	Functional significance of UDP-glucuronosyltransferase variants in the metabolism of active tamoxifen metabolites. Cancer Res. 2009 Mar 1;69(5):1892-900.
75	The impact of pharmacogenetics of metabolic enzymes and transporters on the pharmacokinetics of telmisartan in healthy volunteers. Pharmacogenet Genomics. 2011 Sep;21(9):523-30.
76	Actual and Predicted Pharmacokinetic Interactions Between Anticonvulsants and Antiretrovirals.
77	Role of human UGT2B10 in N-glucuronidation of tricyclic antidepressants, amitriptyline, imipramine, clomipramine, and trimipramine. Drug Metab Dispos. 2010 May;38(5):863-70.
78	Troglitazone glucuronidation in human liver and intestine microsomes: high catalytic activity of UGT1A8 and UGT1A10. Drug Metab Dispos. 2002 Dec;30(12):1462-9.
79	Effect of aging on glucuronidation of valproic acid in human liver microsomes and the role of UDP-glucuronosyltransferase UGT1A4, UGT1A8, and UGT1A10. Drug Metab Dispos. 2009 Jan;37(1):229-36.
80	A pharmacogenetic study of vorinostat glucuronidation. Pharmacogenet Genomics. 2010 Oct;20(10):638-41.
81	Assessing cytochrome P450 and UDP-glucuronosyltransferase contributions to warfarin metabolism in humans. Chem Res Toxicol. 2009 Jul;22(7):1239-45.
82	Interindividual variability in pharmacokinetics of generic nucleoside reverse transcriptase inhibitors in TB/HIV-coinfected Ghanaian patients: UGT2B7*1c is associated with faster zidovudine clearance and glucuronidation. J Clin Pharmacol. 2009 Sep;49(9):1079-90.
83	UDP-glucuronosyltransferase 2B15 (UGT2B15) and UGT2B17 enzymes are major determinants of the androgen response in prostate cancer LNCaP cells. J Biol Chem. 2007 Nov 16;282(46):33466-74.
84	Inversion of the anomeric configuration of the transferred sugar during inactivation of the macrolide antibiotic oleandomycin catalyzed by a macrolide glycosyltransferase. FEBS Lett. 2000 Jul 7;476(3):186-9.
85	Role of UDP-glucuronosyltransferase 1A1 in the metabolism and pharmacokinetics of silymarin flavonolignans in patients with HCV and NAFLD. Molecules. 2017 Jan 15;22(1). pii: E142.
86	Delafloxacin: place in therapy and review of microbiologic, clinical and pharmacologic properties. Infect Dis Ther. 2018 Jun;7(2):197-217.
87	Carisbamate addon therapy for drugresistant partial epilepsy. The Cochrane Library. John Wiley Sons, Ltd, 2016.
88	Differential and special properties of the major human UGT1-encoded gastrointestinal UDP-glucuronosyltransferases enhance potential to control chemical uptake. J Biol Chem. 2004 Jan 9;279(2):1429-41.
89	Disposition and metabolism of cabotegravir: a comparison of biotransformation and excretion between different species and routes of administration in humans. Xenobiotica. 2016;46(2):147-62.
90	Pradigastat disposition in humans: in vivo and in vitro investigations. Xenobiotica. 2017 Dec;47(12):1077-1089.
91	Characterization of the UDP glucuronosyltransferase activity of human liver microsomes genotyped for the UGT1A1*28 polymorphism. Drug Metab Dispos. 2007 Dec;35(12):2270-80.
92	FDA label of Selinexor. The 2020 official website of the U.S. Food and Drug Administration.
93	Identification of aspartic acid and histidine residues mediating the reaction mechanism and the substrate specificity of the human UDP-glucuronosyltransferases 1A. J Biol Chem. 2007 Dec 14;282(50):36514-24.
94	Preclinical discovery of candidate genes to guide pharmacogenetics during phase I development: the example of the novel anticancer agent ABT-751. Pharmacogenet Genomics. 2013 Jul;23(7):374-81.
95	Glucuronidation of active tamoxifen metabolites by the human UDP glucuronosyltransferases. Drug Metab Dispos. 2007 Nov;35(11):2006-14.
96	Paracetamol glucuronidation by recombinant rat and human phenol UDP-glucuronosyltransferases. Biochem Pharmacol. 1993 May 5;45(9):1809-14.
97	Induction and inhibition of cicletanine metabolism in cultured hepatocytes and liver microsomes from rats. Fundam Clin Pharmacol. 2000 Sep-Oct;14(5):509-18.
98	Effects of green tea compounds on irinotecan metabolism. Drug Metab Dispos. 2007 Feb;35(2):228-33.
99	Effects of UGT1A1 genotype on the pharmacokinetics, pharmacodynamics, and toxicities of belinostat administered by 48-hour continuous infusion in patients with cancer. J Clin Pharmacol. 2016 Apr;56(4):461-73.
100	Metabolism Of Antiretroviral Drugs Used In Hiv Preexposure Prophylaxis
101	In vitro inhibitory effects of non-steroidal anti-inflammatory drugs on 4-methylumbelliferone glucuronidation in recombinant human UDP-glucuronosyltransferase 1A9--potent inhibition by niflumic acid. Biopharm Drug Dispos. 2006 Jan;27(1):1-6.
102	Metabolism and excretion of capravirine, a new non-nucleoside reverse transcriptase inhibitor, alone and in combination with ritonavir in healthy volunteers. Drug Metab Dispos. 2004 Jul;32(7):689-98.
103	Bictegravir, a novel integrase inhibitor for the treatment of HIV infection. Drugs Today (Barc). 2019 Nov;55(11):669-682.
104	Phase I clinical and pharmacogenetic study of weekly TAS-103 in patients with advanced cancer. J Clin Oncol. 2001 Apr 1;19(7):2084-90.
105	Inhibition of UDP-glucuronyltransferase activity in rat liver microsomes by pyrimidine derivatives. Comp Biochem Physiol C Pharmacol Toxicol Endocrinol. 1995 Nov;112(3):321-5.