Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1FGRQX)

• DOT Name: Caveolin-2 (CAV2)
• Gene Name: CAV2
• Related Disease:
  Parkinson disease
  Adult glioblastoma
  Advanced cancer
  Anemia
  Atrial fibrillation
  Benign prostatic hyperplasia
  Bipolar disorder
  Bone osteosarcoma
  Breast carcinoma
  Carcinoma of esophagus
  Cerebral infarction
  Childhood acute lymphoblastic leukemia
  Colon carcinoma
  Colonic neoplasm
  Coronary heart disease
  Cystic fibrosis
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Glaucoma/ocular hypertension
  Glioblastoma multiforme
  Kidney cancer
  Lysosomal storage disease
  Neoplasm of esophagus
  Nephropathy
  Open-angle glaucoma
  Osteosarcoma
  Prostate cancer
  Prostate neoplasm
  Renal carcinoma
  Squamous cell carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Familial atrial fibrillation
  Pancreatic cancer
  Renal cell carcinoma
  Rhabdomyosarcoma
  Rheumatoid arthritis
  OPTN-related open angle glaucoma
  Type-1 diabetes
  Acute myelogenous leukaemia
  Amyotrophic lateral sclerosis
  Autoimmune disease
  Breast cancer
  Colorectal carcinoma
  Glioma
  Malignant glioma
  Non-insulin dependent diabetes
  Obesity
• UniProt ID: CAV2_HUMAN
• Pfam ID: PF01146
• Sequence:
  MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
  VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
  TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD
• Function: May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression.
• Tissue Specificity: Expressed in endothelial cells, smooth muscle cells, skeletal myoblasts and fibroblasts.
• KEGG Pathway:
  Endocytosis (hsa04144)
  Focal adhesion (hsa04510)
  Prion disease (hsa05020)
  Bacterial invasion of epithelial cells (hsa05100)
  Proteoglycans in cancer (hsa05205)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway: Extra-nuclear estrogen signaling (R-HSA-9009391)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Definitive	Biomarker	[1]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Anemia	DISTVL0C	Strong	Biomarker	[4]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[5]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[6]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[7]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[9]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[10]
Cerebral infarction	DISR1WNP	Strong	Altered Expression	[11]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[12]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[13]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[14]
Coronary heart disease	DIS5OIP1	Strong	Altered Expression	[15]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[16]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[10]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[10]
Glaucoma/ocular hypertension	DISLBXBY	Strong	Genetic Variation	[17]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Kidney cancer	DISBIPKM	Strong	Biomarker	[3]
Lysosomal storage disease	DIS6QM6U	Strong	Biomarker	[18]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[10]
Nephropathy	DISXWP4P	Strong	Biomarker	[19]
Open-angle glaucoma	DISSZEE8	Strong	Biomarker	[20]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[8]
Prostate cancer	DISF190Y	Strong	Biomarker	[21]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[21]
Renal carcinoma	DISER9XT	Strong	Biomarker	[3]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[10]
Breast neoplasm	DISNGJLM	moderate	Biomarker	[22]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[3]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[23]
Pancreatic cancer	DISJC981	moderate	Altered Expression	[24]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[3]
Rhabdomyosarcoma	DISNR7MS	moderate	Biomarker	[25]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[26]
OPTN-related open angle glaucoma	DISDR98A	Disputed	Genetic Variation	[27]
Type-1 diabetes	DIS7HLUB	Disputed	Biomarker	[28]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[29]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Autosomal dominant	[30]
Autoimmune disease	DISORMTM	Limited	Biomarker	[28]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Limited	Posttranslational Modification	[31]
Glioma	DIS5RPEH	Limited	Biomarker	[32]
Malignant glioma	DISFXKOV	Limited	Biomarker	[32]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[33]
Obesity	DIS47Y1K	Limited	Biomarker	[34]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Taurocholic acid	DM2LZ8F	Phase 1/2	Caveolin-2 (CAV2) increases the secretion of Taurocholic acid.	[56]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Caveolin-2 (CAV2).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Caveolin-2 (CAV2).	[48]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Caveolin-2 (CAV2).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Caveolin-2 (CAV2).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Caveolin-2 (CAV2).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Caveolin-2 (CAV2).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Caveolin-2 (CAV2).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Caveolin-2 (CAV2).	[41]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Caveolin-2 (CAV2).	[42]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Caveolin-2 (CAV2).	[26]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Caveolin-2 (CAV2).	[44]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Caveolin-2 (CAV2).	[45]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Caveolin-2 (CAV2).	[46]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Caveolin-2 (CAV2).	[47]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Caveolin-2 (CAV2).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Caveolin-2 (CAV2).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Caveolin-2 (CAV2).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Caveolin-2 (CAV2).	[52]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Caveolin-2 (CAV2).	[53]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Caveolin-2 (CAV2).	[54]
Hydroxydimethylarsine Oxide	DMPS2B1	Investigative	Hydroxydimethylarsine Oxide decreases the expression of Caveolin-2 (CAV2).	[55]

References

• [1] Exogenous LRRK2G2019S induces parkinsonian-like pathology in a nonhuman primate.JCI Insight. 2018 Jul 26;3(14):e98202. doi: 10.1172/jci.insight.98202. eCollection 2018 Jul 26.
• [2] Interactions of EGFR and caveolin-1 in human glioblastoma cells: evidence that tyrosine phosphorylation regulates EGFR association with caveolae.Oncogene. 2004 Sep 9;23(41):6967-79. doi: 10.1038/sj.onc.1207911.
• [3] CAV2 promotes the growth of renal cell carcinoma through the EGFR/PI3K/Akt pathway.Onco Targets Ther. 2018 Sep 25;11:6209-6216. doi: 10.2147/OTT.S172803. eCollection 2018.
• [4] Severe neurologic disease and chick mortality in crested screamers (Chauna torquata) infected with a novel Gyrovirus.Virology. 2018 Jul;520:111-115. doi: 10.1016/j.virol.2018.05.014. Epub 2018 May 28.
• [5] Targeted sequencing in candidate genes for atrial fibrillation: the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Targeted Sequencing Study.Heart Rhythm. 2014 Mar;11(3):452-7. doi: 10.1016/j.hrthm.2013.11.012. Epub 2013 Nov 14.
• [6] NF-B and GATA-Binding Factor 6 Repress Transcription of Caveolins in Bladder Smooth Muscle Hypertrophy.Am J Pathol. 2019 Apr;189(4):847-867. doi: 10.1016/j.ajpath.2018.12.013. Epub 2019 Jan 30.
• [7] Exploring the associations between genetic variants in genes encoding for subunits of calcium channel and subtypes of bipolar disorder.J Affect Disord. 2014 Mar;157:80-6. doi: 10.1016/j.jad.2013.12.044. Epub 2014 Jan 8.
• [8] Infectivity enhancement for adenoviral transduction of canine osteosarcoma cells.Gene Ther. 2006 Mar;13(5):389-99. doi: 10.1038/sj.gt.3302674.
• [9] The diversity in the expression profile of caveolin II transcripts, considering its new transcript in breast cancer.J Cell Biochem. 2018 Feb;119(2):2168-2178. doi: 10.1002/jcb.26378. Epub 2017 Oct 30.
• [10] The overexpression of caveolin-1 and caveolin-2 correlates with a poor prognosis and tumor progression in esophageal squamous cell carcinoma.Oncol Rep. 2007 Sep;18(3):601-9.
• [11] Inhibition of transient receptor potential vanilloid 4 decreases the expressions of caveolin-1 and caveolin-2 after focal cerebral ischemia and reperfusion in rats.Neuropathology. 2018 Apr 17. doi: 10.1111/neup.12469. Online ahead of print.
• [12] Changes in left ventricular strain parameters following pediatric heart transplantation.Pediatr Transplant. 2018 Aug;22(5):e13166. doi: 10.1111/petr.13166. Epub 2018 Mar 25.
• [13] Overexpression of caveolin-1 in experimental colon adenocarcinomas and human colon cancer cell lines.Oncol Rep. 2004 May;11(5):957-63.
• [14] The scaffolding domain of caveolin 2 is responsible for its Golgi localization in Caco-2 cells.J Cell Sci. 2002 Dec 1;115(Pt 23):4457-67. doi: 10.1242/jcs.00130.
• [15] Vascular restenosis in coronary artery bypass grafting might be associated with VEGF-C/VEGFR-3 signaling pathway.Heart Vessels. 2018 Sep;33(9):1106-1120. doi: 10.1007/s00380-018-1158-9. Epub 2018 Mar 20.
• [16] Exome Sequencing of Phenotypic Extremes Identifies CAV2 and TMC6 as Interacting Modifiers of Chronic Pseudomonas aeruginosa Infection in Cystic Fibrosis.PLoS Genet. 2015 Jun 5;11(6):e1005273. doi: 10.1371/journal.pgen.1005273. eCollection 2015 Jun.
• [17] Expression-associated polymorphisms of CAV1-CAV2 affect intraocular pressure and high-tension glaucoma risk.Mol Vis. 2015 May 11;21:548-54. eCollection 2015.
• [18] Corrective GUSB transfer to the canine mucopolysaccharidosis VII brain.Mol Ther. 2014 Apr;22(4):762-73. doi: 10.1038/mt.2013.283. Epub 2013 Dec 17.
• [19] Novel finding of caveolin-2 in apical membranes of proximal tubule and first detection of caveolin-2 in urine: A promising biomarker of renal disease.J Cell Biochem. 2019 Apr;120(4):4966-4974. doi: 10.1002/jcb.27772. Epub 2018 Sep 30.
• [20] Common variants near CAV1 and CAV2 are associated with primary open-angle glaucoma.Nat Genet. 2010 Oct;42(10):906-9. doi: 10.1038/ng.661. Epub 2010 Sep 12.
• [21] Analysis of candidate genes for prostate cancer.Hum Hered. 2004;57(4):172-8. doi: 10.1159/000081443.
• [22] Cell surface heparan sulfate proteoglycans control adhesion and invasion of breast carcinoma cells.Mol Cancer. 2015 Jan 27;14(1):15. doi: 10.1186/s12943-014-0279-8.
• [23] Genome-wide association study of PR interval.Nat Genet. 2010 Feb;42(2):153-9. doi: 10.1038/ng.517. Epub 2010 Jan 10.
• [24] MiR-29a, targeting caveolin 2 expression, is responsible for limitation of pancreatic cancer metastasis in patients with normal level of serum CA125.Int J Cancer. 2018 Dec 1;143(11):2919-2931. doi: 10.1002/ijc.31654. Epub 2018 Sep 29.
• [25] A whole cell immunization-derived monoclonal antibody that protects cells from coxsackievirus A9 infection binds to both cell surface and virions.J Virol Methods. 2005 Dec;130(1-2):108-16. doi: 10.1016/j.jviromet.2005.06.012. Epub 2005 Aug 1.
• [26] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [27] Investigation of CAV1/CAV2 rs4236601 and CDKN2B-AS1 rs2157719 in primary open-angle glaucoma patients from Brazil.Ophthalmic Genet. 2018 Apr;39(2):194-199. doi: 10.1080/13816810.2017.1393830. Epub 2017 Nov 7.
• [28] Expression of calcium release-activated and voltage-gated calcium channels genes in peripheral blood mononuclear cells is altered in pregnancy and in type 1 diabetes.PLoS One. 2018 Dec 13;13(12):e0208981. doi: 10.1371/journal.pone.0208981. eCollection 2018.
• [29] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [30] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [31] Hypermethylation of the TPEF/HPP1 gene in primary and metastatic colorectal cancers.Neoplasia. 2005 Aug;7(8):771-8. doi: 10.1593/neo.05235.
• [32] Low-frequency ultrasound irradiation increases blood-tumor barrier permeability by transcellular pathway in a rat glioma model.J Mol Neurosci. 2012 Sep;48(1):281-90. doi: 10.1007/s12031-012-9770-0. Epub 2012 Apr 20.
• [33] A two-step association study identifies CAV2 rs2270188 single nucleotide polymorphism interaction with fat intake in type 2 diabetes risk.J Nutr. 2011 Feb;141(2):177-81. doi: 10.3945/jn.110.124206. Epub 2010 Dec 22.
• [34] Dietary obesity increases NO and inhibits BKCa-mediated, endothelium-dependent dilation in rat cremaster muscle artery: association with caveolins and caveolae.Am J Physiol Heart Circ Physiol. 2012 Jun 15;302(12):H2464-76. doi: 10.1152/ajpheart.00965.2011. Epub 2012 Apr 6.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [42] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [43] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [44] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [45] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [46] Differential anti-proliferative actions of peroxisome proliferator-activated receptor-gamma agonists in MCF-7 breast cancer cells. Biochem Pharmacol. 2006 Aug 28;72(5):530-40. doi: 10.1016/j.bcp.2006.05.009. Epub 2006 Jun 27.
• [47] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [50] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [51] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [52] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [53] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [54] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [55] Identification of interspecies concordance of mechanisms of arsenic-induced bladder cancer. Toxicol In Vitro. 2007 Dec;21(8):1513-29. doi: 10.1016/j.tiv.2007.06.021. Epub 2007 Jul 21.
• [56] Hepatic overexpression of caveolins increases bile salt secretion in mice. Hepatology. 2003 Dec;38(6):1477-88. doi: 10.1016/j.hep.2003.09.011.