Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2GH2E5)

• DOT Name: Delta and Notch-like epidermal growth factor-related receptor (DNER)
• Gene Name: DNER
• Related Disease:
  Autism
  Adult glioblastoma
  Autoimmune disease
  Breast cancer
  Cardiac failure
  Castration-resistant prostate carcinoma
  Congestive heart failure
  Epithelial ovarian cancer
  Ewing sarcoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Leukemia
  Medulloblastoma
  Metastatic malignant neoplasm
  Neoplasm
  Neuroblastoma
  Non-insulin dependent diabetes
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Parkinson disease
  Plasma cell myeloma
  Primary cutaneous T-cell lymphoma
  Prostate cancer
  Prostate carcinoma
  Pulmonary fibrosis
  Small lymphocytic lymphoma
  Small-cell lung cancer
  Type-1/2 diabetes
  Urinary bladder neoplasm
  B-cell lymphoma
  Breast carcinoma
  Cardiovascular disease
  Colorectal carcinoma
  leukaemia
  Rheumatoid arthritis
  Chronic obstructive pulmonary disease
  Glioblastoma multiforme
  Acute myelogenous leukaemia
  Adult lymphoma
  Arteriosclerosis
  Asthma
  Atherosclerosis
  Chronic kidney disease
  Lymphoma
  Matthew-Wood syndrome
  Pediatric lymphoma
  Triple negative breast cancer
• UniProt ID: DNER_HUMAN
• Pfam ID: PF19330 ; PF00008 ; PF12661
• Sequence:
  MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
  SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
  CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
  KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
  KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
  VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
  NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
  GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
  TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
  ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
  NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
  ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
  YSPDDKPLVTLIKTKDL
• Function: Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis.
• Tissue Specificity: Expressed in brain, spinal cord and adrenal gland.
• Reactome Pathway: Activated NOTCH1 Transmits Signal to the Nucleus (R-HSA-2122948)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autism	DISV4V1Z	Definitive	Genetic Variation	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Autoimmune disease	DISORMTM	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Cardiac failure	DISDC067	Strong	Biomarker	[5]
Castration-resistant prostate carcinoma	DISVGAE6	Strong	Biomarker	[6]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[7]
Ewing sarcoma	DISQYLV3	Strong	Altered Expression	[8]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Leukemia	DISNAKFL	Strong	Biomarker	[11]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[12]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[14]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[15]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[16]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[7]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[7]
Pancreatic cancer	DISJC981	Strong	Biomarker	[17]
Parkinson disease	DISQVHKL	Strong	Biomarker	[18]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[19]
Primary cutaneous T-cell lymphoma	DIS35WVW	Strong	Altered Expression	[20]
Prostate cancer	DISF190Y	Strong	Biomarker	[6]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[6]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[21]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[22]
Small-cell lung cancer	DISK3LZD	Strong	Genetic Variation	[23]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[16]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[24]
B-cell lymphoma	DISIH1YQ	moderate	Biomarker	[25]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[4]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[26]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[27]
leukaemia	DISS7D1V	moderate	Biomarker	[28]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[29]
Chronic obstructive pulmonary disease	DISQCIRF	Disputed	Biomarker	[30]
Glioblastoma multiforme	DISK8246	Disputed	Altered Expression	[31]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[32]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[33]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[34]
Asthma	DISW9QNS	Limited	Biomarker	[35]
Atherosclerosis	DISMN9J3	Limited	Biomarker	[34]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[36]
Lymphoma	DISN6V4S	Limited	Biomarker	[33]
Matthew-Wood syndrome	DISA7HR7	Limited	Biomarker	[37]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[33]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[38]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[46]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[44]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[45]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[47]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[48]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[49]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[50]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[51]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[52]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[53]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[54]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[55]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[49]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[49]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[56]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[58]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Delta and Notch-like epidermal growth factor-related receptor (DNER).	[59]

References

• [1] Individual common variants exert weak effects on the risk for autism spectrum disorders.Hum Mol Genet. 2012 Nov 1;21(21):4781-92. doi: 10.1093/hmg/dds301. Epub 2012 Jul 26.
• [2] BET and Aurora Kinase A inhibitors synergize against MYCN-positive human glioblastoma cells.Cell Death Dis. 2019 Nov 21;10(12):881. doi: 10.1038/s41419-019-2120-1.
• [3] Pharmacological Inhibition of Bromodomain Proteins Suppresses Retinal Inflammatory Disease and Downregulates Retinal Th17 Cells.J Immunol. 2017 Feb 1;198(3):1093-1103. doi: 10.4049/jimmunol.1600735. Epub 2016 Dec 30.
• [4] Distinct Roles for BET Family Members in Estrogen Receptor Enhancer Function and Gene Regulation in Breast Cancer Cells.Mol Cancer Res. 2019 Dec;17(12):2356-2368. doi: 10.1158/1541-7786.MCR-19-0393. Epub 2019 Sep 24.
• [5] BET bromodomain inhibition suppresses innate inflammatory and profibrotic transcriptional networks in heart failure.Sci Transl Med. 2017 May 17;9(390):eaah5084. doi: 10.1126/scitranslmed.aah5084.
• [6] Maintenance of MYC expression promotes de novo resistance to BET bromodomain inhibition in castration-resistant prostate cancer.Sci Rep. 2019 Mar 7;9(1):3823. doi: 10.1038/s41598-019-40518-5.
• [7] Erratum: Akt/mTOR-Mediated Autophagy Confers Resistance To BET Inhibitor JQ1 In Ovarian Cancer [Corrigendum].Onco Targets Ther. 2019 Nov 15;12:9793. doi: 10.2147/OTT.S236659. eCollection 2019.
• [8] EWS/ETS-Driven Ewing Sarcoma Requires BET Bromodomain Proteins.Cancer Res. 2018 Aug 15;78(16):4760-4773. doi: 10.1158/0008-5472.CAN-18-0484. Epub 2018 Jun 13.
• [9] Impact of Epigenetic Regulation on Head and Neck Squamous Cell Carcinoma.J Dent Res. 2019 Mar;98(3):268-276. doi: 10.1177/0022034518816947. Epub 2019 Jan 7.
• [10] Bromodomain and Extraterminal (BET) Proteins Regulate Hepatocyte Proliferation in Hepatocyte-Driven Liver Regeneration.Am J Pathol. 2018 Jun;188(6):1389-1405. doi: 10.1016/j.ajpath.2018.02.006. Epub 2018 Mar 12.
• [11] BET inhibitors impair leukemic stem cell function only in defined oncogenic subgroups of acute myeloid leukaemias.Leuk Res. 2019 Dec;87:106269. doi: 10.1016/j.leukres.2019.106269. Epub 2019 Nov 7.
• [12] Synergistic activity of BET inhibitor MK-8628 and PLK inhibitor Volasertib in preclinical models of medulloblastoma.Cancer Lett. 2019 Mar 31;445:24-33. doi: 10.1016/j.canlet.2018.12.012. Epub 2019 Jan 4.
• [13] BET protein bromodomain inhibitor-based combinations are highly active against post-myeloproliferative neoplasm secondary AML cells.Leukemia. 2017 Mar;31(3):678-687. doi: 10.1038/leu.2016.260. Epub 2016 Sep 28.
• [14] Overcoming BET Inhibitor Resistance in Malignant Peripheral Nerve Sheath Tumors.Clin Cancer Res. 2019 Jun 1;25(11):3404-3416. doi: 10.1158/1078-0432.CCR-18-2437. Epub 2019 Feb 22.
• [15] TBX2 is a neuroblastoma core regulatory circuitry component enhancing MYCN/FOXM1 reactivation of DREAM targets.Nat Commun. 2018 Nov 19;9(1):4866. doi: 10.1038/s41467-018-06699-9.
• [16] Effect of selective BET protein inhibitor apabetalone on cardiovascular outcomes in patients with acute coronary syndrome and diabetes: Rationale, design, and baseline characteristics of the BETonMACE trial.Am Heart J. 2019 Nov;217:72-83. doi: 10.1016/j.ahj.2019.08.001. Epub 2019 Aug 9.
• [17] Loss of KDM6A Activates Super-Enhancers to Induce Gender-Specific Squamous-like Pancreatic Cancer and Confers Sensitivity to BET Inhibitors.Cancer Cell. 2018 Mar 12;33(3):512-526.e8. doi: 10.1016/j.ccell.2018.02.003.
• [18] Proximity extension assay testing reveals novel diagnostic biomarkers of atypical parkinsonian syndromes.J Neurol Neurosurg Psychiatry. 2019 Jul;90(7):768-773. doi: 10.1136/jnnp-2018-320151. Epub 2019 Mar 13.
• [19] The homeobox transcription factor MEIS2 is a regulator of cancer cell survival and IMiDs activity in Multiple Myeloma: modulation by Bromodomain and Extra-Terminal (BET) protein inhibitors.Cell Death Dis. 2019 Apr 11;10(4):324. doi: 10.1038/s41419-019-1562-9.
• [20] Preclinical Targeting of MicroRNA-214 in Cutaneous T-Cell Lymphoma.J Invest Dermatol. 2019 Sep;139(9):1966-1974.e3. doi: 10.1016/j.jid.2019.01.033. Epub 2019 Mar 12.
• [21] Pharmacological targeting of BET proteins attenuates radiation-induced lung fibrosis.Sci Rep. 2018 Jan 17;8(1):998. doi: 10.1038/s41598-018-19343-9.
• [22] Inhibition of bromodomain and extra-terminal proteins increases sensitivity to venetoclax in chronic lymphocytic leukaemia.J Cell Mol Med. 2020 Jan;24(2):1650-1657. doi: 10.1111/jcmm.14857. Epub 2019 Dec 10.
• [23] NK Cells Mediate Synergistic Antitumor Effects of Combined Inhibition of HDAC6 and BET in a SCLC Preclinical Model.Cancer Res. 2018 Jul 1;78(13):3709-3717. doi: 10.1158/0008-5472.CAN-18-0161. Epub 2018 May 14.
• [24] BET inhibitor JQ1 suppresses cell proliferation via inducing autophagy and activating LKB1/AMPK in bladder cancer cells.Cancer Med. 2019 Aug;8(10):4792-4805. doi: 10.1002/cam4.2385. Epub 2019 Jun 28.
• [25] Pharmacological modulation of CXCR4 cooperates with BET bromodomain inhibition in diffuse large B-cell lymphoma.Haematologica. 2019 Apr;104(4):778-788. doi: 10.3324/haematol.2017.180505. Epub 2018 Jun 28.
• [26] Pharmacologic epigenetic modulators of alkaline phosphatase in chronic kidney disease.Curr Opin Nephrol Hypertens. 2020 Jan;29(1):4-15. doi: 10.1097/MNH.0000000000000570.
• [27] Co-inhibition of BET proteins and NF-B as a potential therapy for colorectal cancer through synergistic inhibiting MYC and FOXM1 expressions.Cell Death Dis. 2018 Feb 22;9(3):315. doi: 10.1038/s41419-018-0354-y.
• [28] Chromatin regulator Asxl1 loss and Nf1 haploinsufficiency cooperate to accelerate myeloid malignancy.J Clin Invest. 2018 Dec 3;128(12):5383-5398. doi: 10.1172/JCI121366. Epub 2018 Oct 29.
• [29] TNF-induced inflammatory genes escape repression in fibroblast-like synoviocytes: transcriptomic and epigenomic analysis.Ann Rheum Dis. 2019 Sep;78(9):1205-1214. doi: 10.1136/annrheumdis-2018-214783. Epub 2019 May 16.
• [30] The Notch ligand DNER regulates macrophage IFN release in chronic obstructive pulmonary disease.EBioMedicine. 2019 May;43:562-575. doi: 10.1016/j.ebiom.2019.03.054. Epub 2019 May 4.
• [31] Intron 1-Mediated Regulation of EGFR Expression in EGFR-Dependent Malignancies Is Mediated by AP-1 and BET Proteins.Mol Cancer Res. 2019 Nov;17(11):2208-2220. doi: 10.1158/1541-7786.MCR-19-0747. Epub 2019 Aug 23.
• [32] RUNX1-targeted therapy for AML expressing somatic or germline mutation in RUNX1.Blood. 2019 Jul 4;134(1):59-73. doi: 10.1182/blood.2018893982. Epub 2019 Apr 25.
• [33] BET Inhibition-Induced GSK3 Feedback Enhances Lymphoma Vulnerability to PI3K Inhibitors.Cell Rep. 2018 Aug 21;24(8):2155-2166. doi: 10.1016/j.celrep.2018.07.055.
• [34] Selective BET Protein Inhibition with Apabetalone and Cardiovascular Events: A Pooled Analysis of Trials in Patients with Coronary Artery Disease.Am J Cardiovasc Drugs. 2018 Apr;18(2):109-115. doi: 10.1007/s40256-017-0250-3.
• [35] Bromodomain and Extra-Terminal Protein Inhibition Attenuates Neutrophil-dominant Allergic Airway Disease.Sci Rep. 2017 Feb 24;7:43139. doi: 10.1038/srep43139.
• [36] Bromodomain and Extraterminal Proteins as Novel Epigenetic Targets for Renal Diseases.Front Pharmacol. 2019 Nov 8;10:1315. doi: 10.3389/fphar.2019.01315. eCollection 2019.
• [37] The BET inhibitor JQ1 attenuates double-strand break repair and sensitizes models of pancreatic ductal adenocarcinoma to PARP inhibitors.EBioMedicine. 2019 Jun;44:419-430. doi: 10.1016/j.ebiom.2019.05.035. Epub 2019 May 22.
• [38] GSK2801, a BAZ2/BRD9 Bromodomain Inhibitor, Synergizes with BET Inhibitors to Induce Apoptosis in Triple-Negative Breast Cancer.Mol Cancer Res. 2019 Jul;17(7):1503-1518. doi: 10.1158/1541-7786.MCR-18-1121. Epub 2019 Apr 18.
• [39] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [42] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [45] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [46] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [47] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [48] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [49] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [50] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [51] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [52] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [53] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [54] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [55] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [56] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [57] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [58] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [59] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.