Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4DLRYY)

• DOT Name: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1)
• Synonyms: 130 kDa phosphatidylinositol 4,5-bisphosphate-dependent ARF1 GTPase-activating protein; ADP-ribosylation factor-directed GTPase-activating protein 1; ARF GTPase-activating protein 1; Development and differentiation-enhancing factor 1; DEF-1; Differentiation-enhancing factor 1; PIP2-dependent ARF1 GAP
• Gene Name: ASAP1
• Related Disease:
  Obstructive sleep apnea
  Parkinson disease
  Adult glioblastoma
  Atrial fibrillation
  Breast carcinoma
  Cervical cancer
  Cervical carcinoma
  Classic Hodgkin lymphoma
  Colitis
  Colorectal carcinoma
  Crohn disease
  Glioblastoma multiforme
  Head and neck cancer
  Head and neck carcinoma
  Head-neck squamous cell carcinoma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Huntington disease
  Juvenile idiopathic arthritis
  leukaemia
  Leukemia
  Melanoma
  Neoplasm
  Obesity
  Pancreatic cancer
  Post-traumatic stress disorder
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Sleep apnea syndrome
  Systemic lupus erythematosus
  Systemic sclerosis
  Type-1/2 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
  Breast cancer
  Cervical Intraepithelial neoplasia
  Cholangiocarcinoma
  Progressive supranuclear palsy
  Amyotrophic lateral sclerosis
  Chronic obstructive pulmonary disease
  Human papillomavirus infection
  Metastatic malignant neoplasm
  Pancreatitis
  Psychotic disorder
  Pulmonary tuberculosis
  Schizophrenia
• UniProt ID: ASAP1_HUMAN
• PDB ID: 2D1X; 2DA0; 2ED1; 2RQT; 2RQU
• Pfam ID: PF12796 ; PF01412 ; PF16746 ; PF00169 ; PF14604
• Sequence:
  MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
  EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
  FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
  EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
  IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
  QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
  SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
  MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
  HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
  EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
  GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
  PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
  LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
  DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
  PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
  VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
  ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
  SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
  DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
• Function: Possesses phosphatidylinositol 4,5-bisphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types. Part of the ciliary targeting complex containing Rab11, ASAP1, Rabin8/RAB3IP, RAB11FIP3 and ARF4, which direct preciliary vesicle trafficking to mother centriole and ciliogenesis initiation.
• KEGG Pathway:
  Endocytosis (hsa04144)
  Fc gamma R-mediated phagocytosis (hsa04666)
• Reactome Pathway: VxPx cargo-targeting to cilium (R-HSA-5620916)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Obstructive sleep apnea	DIS0SVD1	Definitive	Biomarker	[1]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Cervical cancer	DISFSHPF	Strong	Biomarker	[6]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[6]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[7]
Colitis	DISAF7DD	Strong	Biomarker	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[9]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[10]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[3]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[11]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[11]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[12]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Huntington disease	DISQPLA4	Strong	Biomarker	[7]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[15]
leukaemia	DISS7D1V	Strong	Altered Expression	[16]
Leukemia	DISNAKFL	Strong	Genetic Variation	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Obesity	DIS47Y1K	Strong	Biomarker	[19]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[20]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[22]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[22]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[22]
Sleep apnea syndrome	DISER6KS	Strong	Biomarker	[23]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[24]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[25]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[19]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[26]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[26]
Breast cancer	DIS7DPX1	moderate	Biomarker	[5]
Cervical Intraepithelial neoplasia	DISXP757	moderate	Genetic Variation	[27]
Cholangiocarcinoma	DIS71F6X	moderate	Genetic Variation	[28]
Progressive supranuclear palsy	DISO5KRQ	moderate	Genetic Variation	[29]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[30]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[31]
Human papillomavirus infection	DISX61LX	Limited	Genetic Variation	[32]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[33]
Pancreatitis	DIS0IJEF	Limited	Altered Expression	[34]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[35]
Pulmonary tuberculosis	DIS6FLUM	Limited	Biomarker	[36]
Schizophrenia	DISSRV2N	Limited	Genetic Variation	[37]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[38]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[26]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[51]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[53]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[42]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[43]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[45]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[46]
Marinol	DM70IK5	Approved	Marinol increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[47]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[48]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[49]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[50]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[52]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[55]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (ASAP1).	[43]

References

• [1] Polysomnographic determinants of requirement for advanced positive pressure therapeutic options for obstructive sleep apnea.Sleep Breath. 2018 May;22(2):401-409. doi: 10.1007/s11325-017-1556-8. Epub 2017 Aug 18.
• [2] Treating sleep apnea in Parkinson's disease with C-PAP: feasibility concerns and effects on cognition and alertness.Sleep Med. 2017 May;33:114-118. doi: 10.1016/j.sleep.2017.01.009. Epub 2017 Jan 27.
• [3] The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.Int J Biochem Cell Biol. 2014 Apr;49:8-16. doi: 10.1016/j.biocel.2014.01.007. Epub 2014 Jan 13.
• [4] Improvement in Sleep-Disordered Breathing Indices Downloaded From a Positive Airway Pressure Machine Following Conversion of Atrial Fibrillation to Sinus Rhythm.J Clin Sleep Med. 2018 Nov 15;14(11):1953-1957. doi: 10.5664/jcsm.7502.
• [5] CCL18-dependent translocation of AMAP1 is critical for epithelial to mesenchymal transition in breast cancer.J Cell Physiol. 2018 Apr;233(4):3207-3217. doi: 10.1002/jcp.26164. Epub 2017 Sep 27.
• [6] Early diagnosis behavior in Turkish women with and without a family history of cervical cancer.Asian Pac J Cancer Prev. 2015;16(2):401-6. doi: 10.7314/apjcp.2015.16.2.401.
• [7] Infrainguinal bypass surgery outcomes are worse in hemodialysis patients compared with patients with renal transplants.J Vasc Surg. 2019 Mar;69(3):850-856. doi: 10.1016/j.jvs.2018.05.252. Epub 2018 Dec 21.
• [8] Oral delivery of pancreatitis-associated protein by Lactococcus lactis displays protective effects in dinitro-benzenesulfonic-acid-induced colitis model and is able to modulate the composition of the microbiota.Environ Microbiol. 2019 Nov;21(11):4020-4031. doi: 10.1111/1462-2920.14748. Epub 2019 Sep 10.
• [9] ASAP1 promotes tumor cell motility and invasiveness, stimulates metastasis formation in vivo, and correlates with poor survival in colorectal cancer patients.Oncogene. 2010 Apr 22;29(16):2393-403. doi: 10.1038/onc.2010.6. Epub 2010 Feb 15.
• [10] Alpha-defensins (-Defs) in Crohn's disease: decrease of ileal -Def 5 via permanent methylation and increase in plasma -Def 1-3 concentrations offering biomarker utility.Clin Exp Immunol. 2018 Apr;192(1):120-128. doi: 10.1111/cei.13085. Epub 2018 Jan 10.
• [11] Inhibition of epithelial-mesenchymal transition by cetuximab via the EGFR-GEP100-Arf6-AMAP1 pathway in head and neck cancer.Head Neck. 2017 Mar;39(3):476-485. doi: 10.1002/hed.24626. Epub 2016 Nov 23.
• [12] High level expression of AMAP1 protein correlates with poor prognosis and survival after surgery of head and neck squamous cell carcinoma patients.Cell Commun Signal. 2014 Mar 12;12:17. doi: 10.1186/1478-811X-12-17.
• [13] Inhibition of hepatitis B virus replication by pokeweed antiviral protein in vitro.World J Gastroenterol. 2008 Mar 14;14(10):1592-7. doi: 10.3748/wjg.14.1592.
• [14] eIF5B increases ASAP1 expression to promote HCC proliferation and invasion.Oncotarget. 2016 Sep 20;7(38):62327-62339. doi: 10.18632/oncotarget.11469.
• [15] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [16] Effective immunochemotherapy of human t(4;11) leukemia in mice with severe combined immunodeficiency (SCID) using B43 (anti-CD19)-pokeweed antiviral protein immunotoxin plus cyclophosphamide.Leukemia. 1993 Feb;7(2):290-7.
• [17] DDEF1 is located in an amplified region of chromosome 8q and is overexpressed in uveal melanoma.Clin Cancer Res. 2005 May 15;11(10):3609-13. doi: 10.1158/1078-0432.CCR-04-1941.
• [18] Detection of high-grade neoplasia in air-dried cervical PAP smears by a microRNA-based classifier.Oncol Rep. 2018 Mar;39(3):1099-1111. doi: 10.3892/or.2018.6214. Epub 2018 Jan 12.
• [19] Mutations in MKKS cause Bardet-Biedl syndrome.Nat Genet. 2000 Sep;26(1):15-6. doi: 10.1038/79116.
• [20] ARF6 and AMAP1 are major targets of KRAS and TP53 mutations to promote invasion, PD-L1 dynamics, and immune evasion of pancreatic cancer.Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17450-17459. doi: 10.1073/pnas.1901765116. Epub 2019 Aug 9.
• [21] Treatment of OSA with CPAP Is Associated with Improvement in PTSD Symptoms among Veterans.J Clin Sleep Med. 2017 Jan 15;13(1):57-63. doi: 10.5664/jcsm.6388.
• [22] ASAP1, a gene at 8q24, is associated with prostate cancer metastasis.Cancer Res. 2008 Jun 1;68(11):4352-9. doi: 10.1158/0008-5472.CAN-07-5237.
• [23] Economic Assessment of 4 Approaches to the Diagnosis and Initial Treatment of Sleep Apnea.Respir Care. 2018 Jan;63(1):50-61. doi: 10.4187/respcare.05355. Epub 2017 Oct 24.
• [24] Evaluation of pulmonary artery pressure in patients with juvenile systemic lupus erythematosus (jSLE).Bosn J Basic Med Sci. 2018 Feb 20;18(1):66-71. doi: 10.17305/bjbms.2017.2178.
• [25] Changes in pulmonary exercise haemodynamics in scleroderma: a 4-year prospective study.Eur Respir J. 2017 Jul 13;50(1):1601708. doi: 10.1183/13993003.01708-2016. Print 2017 Jul.
• [26] Identification of novel gene targets and putative regulators of arsenic-associated DNA methylation in human urothelial cells and bladder cancer. Chem Res Toxicol. 2015 Jun 15;28(6):1144-55. doi: 10.1021/tx500393y. Epub 2015 Jun 3.
• [27] Adherence to gynecological screening impacted by experienced orthodontic treatment in childhood.Arch Gynecol Obstet. 2019 Jan;299(1):167-171. doi: 10.1007/s00404-018-4950-y. Epub 2018 Oct 30.
• [28] Role for interleukin-6 in COPD-related pulmonary hypertension.Chest. 2009 Sep;136(3):678-687. doi: 10.1378/chest.08-2420. Epub 2009 Apr 6.
• [29] Joint genome-wide association study of progressive supranuclear palsy identifies novel susceptibility loci and genetic correlation to neurodegenerative diseases.Mol Neurodegener. 2018 Aug 8;13(1):41. doi: 10.1186/s13024-018-0270-8.
• [30] Associative Increases in Amyotrophic Lateral Sclerosis Survival Duration With Non-invasive Ventilation Initiation and Usage Protocols.Front Neurol. 2018 Jul 12;9:578. doi: 10.3389/fneur.2018.00578. eCollection 2018.
• [31] The evaluation of cardiac functions according to chronic obstructive pulmonary disease groups.Aging Male. 2020 Jun;23(2):106-111. doi: 10.1080/13685538.2019.1606191. Epub 2019 Apr 30.
• [32] Prevalence of human papillomavirus infection in women in the Autonomous Region of Inner Mongolia: A population-based study of a Chinese ethnic minority.J Med Virol. 2018 Jan;90(1):148-156. doi: 10.1002/jmv.24888. Epub 2017 Oct 6.
• [33] Lentiviral vector mediated-ASAP1 expression promotes epithelial to mesenchymal transition in ovarian cancer cells.Oncol Lett. 2018 Apr;15(4):4432-4438. doi: 10.3892/ol.2018.7834. Epub 2018 Jan 22.
• [34] PAP/REG3A favors perineural invasion in pancreatic adenocarcinoma and serves as a prognostic marker.Cell Mol Life Sci. 2017 Nov;74(22):4231-4243. doi: 10.1007/s00018-017-2579-9. Epub 2017 Jun 27.
• [35] Increased frequency of psychosis after second-generation antiepileptic drug administration in adults with focal epilepsy.Epilepsy Behav. 2019 Aug;97:138-143. doi: 10.1016/j.yebeh.2019.06.002. Epub 2019 Jun 25.
• [36] Susceptibility to tuberculosis is associated with variants in the ASAP1 gene encoding a regulator of dendritic cell migration.Nat Genet. 2015 May;47(5):523-527. doi: 10.1038/ng.3248. Epub 2015 Mar 16.
• [37] Genome-wide association study of schizophrenia in Ashkenazi Jews.Am J Med Genet B Neuropsychiatr Genet. 2015 Dec;168(8):649-59. doi: 10.1002/ajmg.b.32349. Epub 2015 Jul 21.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [40] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [41] Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [44] Identification of novel gene targets and putative regulators of arsenic-associated DNA methylation in human urothelial cells and bladder cancer. Chem Res Toxicol. 2015 Jun 15;28(6):1144-55. doi: 10.1021/tx500393y. Epub 2015 Jun 3.
• [45] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [46] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [47] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [48] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [49] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [50] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [51] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [52] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [53] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [54] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [55] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.