Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4R3EAC)

DOT Name	Sorcin (SRI)
Synonyms	22 kDa protein; CP-22; CP22; V19
Gene Name	SRI
Related Disease	Epilepsy ( ) Acute coronary syndrome ( ) Acute erythroid leukemia ( ) Acute myelogenous leukaemia ( ) Advanced cancer ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Bladder cancer ( ) Cardiac failure ( ) Cardiomyopathy ( ) Childhood acute lymphoblastic leukemia ( ) Colorectal carcinoma ( ) Congestive heart failure ( ) Cystic fibrosis ( ) Depression ( ) Fatty liver disease ( ) Gastric adenocarcinoma ( ) Gastric cancer ( ) Huntington disease ( ) leukaemia ( ) Leukemia ( ) Lupus ( ) Lyme disease ( ) Neuralgia ( ) Non-insulin dependent diabetes ( ) Obsessive compulsive disorder ( ) Obstructive sleep apnea ( ) Pancytopenia ( ) Plasma cell myeloma ( ) Severe congenital neutropenia ( ) Stomach cancer ( ) Urinary bladder cancer ( ) Urinary bladder neoplasm ( ) Head-neck squamous cell carcinoma ( ) Hepatocellular carcinoma ( ) Nasopharyngeal carcinoma ( ) Glioma ( ) Neoplasm ( ) Adult lymphoma ( ) Breast cancer ( ) Breast carcinoma ( ) Lymphoma ( ) Metastatic malignant neoplasm ( ) Pediatric lymphoma ( ) Rett syndrome ( ) Systemic lupus erythematosus ( ) Hypertrophic cardiomyopathy ( )
UniProt ID	SORCN_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1JUO; 2JC2; 4U8D; 4UPG; 4USL; 5MRA
Pfam ID	PF13499 ; PF13833
Sequence	MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTV DPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQ QGVVNFPYDDFIQCVMSV
Function	Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.
Tissue Specificity	Detected in cardiac myocytes.
Reactome Pathway	Reduction of cytosolic Ca++ levels (R-HSA-418359 ) Sodium/Calcium exchangers (R-HSA-425561 ) Ion homeostasis (R-HSA-5578775 ) Ion transport by P-type ATPases (R-HSA-936837 ) Stimuli-sensing channels (R-HSA-2672351 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Epilepsy	DISBB28L	Definitive	Genetic Variation	[1]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[2]
Acute erythroid leukemia	DISZFC1O	Strong	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[7]
Cardiac failure	DISDC067	Strong	Biomarker	[8]
Cardiomyopathy	DISUPZRG	Strong	Altered Expression	[8]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[8]
Cystic fibrosis	DIS2OK1Q	Strong	Biomarker	[11]
Depression	DIS3XJ69	Strong	Biomarker	[12]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[13]
Gastric adenocarcinoma	DISWWLTC	Strong	Genetic Variation	[7]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[14]
Huntington disease	DISQPLA4	Strong	Biomarker	[15]
leukaemia	DISS7D1V	Strong	Altered Expression	[16]
Leukemia	DISNAKFL	Strong	Altered Expression	[16]
Lupus	DISOKJWA	Strong	Genetic Variation	[17]
Lyme disease	DISO70G5	Strong	Genetic Variation	[18]
Neuralgia	DISWO58J	Strong	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[20]
Obsessive compulsive disorder	DIS1ZMM2	Strong	Genetic Variation	[21]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[20]
Pancytopenia	DISVKEHV	Strong	Biomarker	[22]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[23]
Severe congenital neutropenia	DISES99N	Strong	Biomarker	[24]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[14]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[7]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Altered Expression	[25]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[26]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[27]
Glioma	DIS5RPEH	Disputed	Biomarker	[28]
Neoplasm	DISZKGEW	Disputed	Altered Expression	[5]
Adult lymphoma	DISK8IZR	Limited	Altered Expression	[29]
Breast cancer	DIS7DPX1	Limited	Biomarker	[30]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[30]
Lymphoma	DISN6V4S	Limited	Altered Expression	[29]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[5]
Pediatric lymphoma	DIS51BK2	Limited	Altered Expression	[29]
Rett syndrome	DISGG5UV	Limited	Biomarker	[31]
Systemic lupus erythematosus	DISI1SZ7	Limited	Biomarker	[32]
Hypertrophic cardiomyopathy	DISQG2AI	Refuted	Autosomal dominant	[33]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Sorcin (SRI) decreases the response to substance of Fluorouracil.	[53]
Paclitaxel	DMLB81S	Approved	Sorcin (SRI) decreases the response to substance of Paclitaxel.	[53]
Topotecan	DMP6G8T	Approved	Sorcin (SRI) affects the response to substance of Topotecan.	[54]
------------------------------------------------------------------------------------

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sorcin (SRI).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sorcin (SRI).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Sorcin (SRI).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Sorcin (SRI).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Sorcin (SRI).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Sorcin (SRI).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Sorcin (SRI).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Sorcin (SRI).	[42]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Sorcin (SRI).	[44]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Sorcin (SRI).	[45]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Sorcin (SRI).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Sorcin (SRI).	[47]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Sorcin (SRI).	[49]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Sorcin (SRI).	[50]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Sorcin (SRI).	[38]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Sorcin (SRI).	[51]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Sorcin (SRI).	[52]
------------------------------------------------------------------------------------


⏷ Show the Full List of 17 Drug(s)

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Sorcin (SRI).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine affects the methylation of Sorcin (SRI).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Sorcin (SRI).	[48]
------------------------------------------------------------------------------------

References

1	Heart rate variability in epilepsy: A potential biomarker of sudden unexpected death in epilepsy risk.Epilepsia. 2018 Jul;59(7):1372-1380. doi: 10.1111/epi.14438. Epub 2018 Jun 6.
2	Application of Risks Scores in Acute Coronary Syndromes. How Does ProACS Hold Up Against Other Risks Scores?.Arq Bras Cardiol. 2019 Jun 27;113(1):20-30. doi: 10.5935/abc.20190109.
3	A human cDNA corresponding to a gene overexpressed during cell proliferation encodes a product sharing homology with amoebic and bacterial proteins.J Biol Chem. 1993 May 25;268(15):11050-6.
4	Expression of sorcin predicts poor outcome in acute myeloid leukemia.Leuk Res. 2003 Feb;27(2):125-31. doi: 10.1016/s0145-2126(02)00083-8.
5	Pan-cancer Convergence to a Small-Cell Neuroendocrine Phenotype that Shares Susceptibilities with Hematological Malignancies.Cancer Cell. 2019 Jul 8;36(1):17-34.e7. doi: 10.1016/j.ccell.2019.06.005.
6	Thiocyanate supplementation decreases atherosclerotic plaque in mice expressing human myeloperoxidase.Free Radic Res. 2015 Jun;49(6):743-9. doi: 10.3109/10715762.2015.1019347. Epub 2015 Mar 27.
7	Sorcin a Potential Molecular Target for Cancer Therapy.Transl Oncol. 2018 Dec;11(6):1379-1389. doi: 10.1016/j.tranon.2018.08.015. Epub 2018 Sep 11.
8	miR-1 mediated suppression of Sorcin regulates myocardial contractility through modulation of Ca2+ signaling.J Mol Cell Cardiol. 2012 May;52(5):1027-37. doi: 10.1016/j.yjmcc.2012.01.020. Epub 2012 Feb 4.
9	Overexpression of SORCIN is a Prognostic Biomarker for Multidrug-Resistant Pediatric Acute Lymphoblastic Leukemia and Correlates with Upregulated MDR1/P-gp.Genet Test Mol Biomarkers. 2016 Sep;20(9):516-21. doi: 10.1089/gtmb.2016.0031. Epub 2016 Jul 6.
10	Sorcin Enhances Metastasis and Promotes Epithelial-to-Mesenchymal Transition of Colorectal Cancer.Cell Biochem Biophys. 2015 Jun;72(2):453-9. doi: 10.1007/s12013-014-0486-3.
11	The thiocyanate analog selenocyanate is a more potent antimicrobial pro-drug that also is selectively detoxified by the host.Free Radic Biol Med. 2020 Jan;146:324-332. doi: 10.1016/j.freeradbiomed.2019.11.016. Epub 2019 Nov 15.
12	Desipramine restores the alterations in circadian entrainment induced by prenatal exposure to glucocorticoids.Transl Psychiatry. 2019 Oct 17;9(1):263. doi: 10.1038/s41398-019-0594-3.
13	Chronic exposure to Pb(2+) perturbs ChREBP transactivation and coerces hepatic dyslipidemia.FEBS Lett. 2019 Nov;593(21):3084-3097. doi: 10.1002/1873-3468.13538. Epub 2019 Jul 27.
14	miR? reverses multidrug resistance in gastric cancer cells via downregulation of sorcin through promoting the accumulation of intracellular drugs and apoptosis of cells.Int J Oncol. 2019 Aug;55(2):451-461. doi: 10.3892/ijo.2019.4831. Epub 2019 Jun 25.
15	Pathophysiology in the suprachiasmatic nucleus in mouse models of Huntington's disease.J Neurosci Res. 2018 Dec;96(12):1862-1875. doi: 10.1002/jnr.24320. Epub 2018 Aug 31.
16	Sorcin, an important gene associated with multidrug-resistance in human leukemia cells.Leuk Res. 2006 Apr;30(4):469-76. doi: 10.1016/j.leukres.2005.08.024. Epub 2005 Oct 6.
17	Clinical SLEDAI-2K zero may be a pragmatic outcome measure in SLE studies.Expert Opin Biol Ther. 2019 Feb;19(2):157-168. doi: 10.1080/14712598.2019.1561856. Epub 2018 Dec 27.
18	Immunolocalization of a 22 kDa protein (IPLA7, P22) of Borrelia burgdorferi.FEMS Microbiol Lett. 1996 May 1;138(2-3):215-9. doi: 10.1111/j.1574-6968.1996.tb08160.x.
19	A Novel Mu-Delta Opioid Agonist Demonstrates Enhanced Efficacy With Reduced Tolerance and Dependence in Mouse Neuropathic Pain Models.J Pain. 2020 Jan-Feb;21(1-2):146-160. doi: 10.1016/j.jpain.2019.05.017. Epub 2019 Jun 12.
20	Responsiveness of Patient-Reported Outcomes to Treatment Among Patients With Type 2 Diabetes Mellitus and OSA.Chest. 2020 Mar;157(3):665-672. doi: 10.1016/j.chest.2019.11.011. Epub 2019 Nov 27.
21	Detrimental effect of clomipramine on hippocampus-dependent learning in an animal model of obsessive-compulsive disorder induced by sensitization with d2/d3 agonist quinpirole.Behav Brain Res. 2017 Jan 15;317:210-217. doi: 10.1016/j.bbr.2016.09.042. Epub 2016 Sep 19.
22	VPS 45-associated primary infantile myelofibrosis--successful treatment with hematopoietic stem cell transplantation.Pediatr Transplant. 2013 Dec;17(8):820-5. doi: 10.1111/petr.12169.
23	shRNA-mediated silencing of sorcin increases drug chemosensitivity in myeloma KM3/DDP and U266/ADM cell lines.Int J Clin Exp Pathol. 2015 Mar 1;8(3):2300-10. eCollection 2015.
24	Severe congenital neutropenia in a multigenerational family with a novel neutrophil elastase (ELANE) mutation.Ann Hematol. 2011 Feb;90(2):151-8. doi: 10.1007/s00277-010-1056-4. Epub 2010 Aug 28.
25	Synthesis and preclinical investigation of (99m)Tc-p-SCN-Bzl-DTPA-cetuximab for targeting EGFR using head and neck squamous cell carcinoma (HNSCC) xenografts.Mol Biol Rep. 2019 Apr;46(2):1675-1682. doi: 10.1007/s11033-019-04616-x. Epub 2019 Jan 24.
26	Sorcin Predicts Poor Prognosis and Promotes Metastasis by Facilitating Epithelial-mesenchymal Transition in Hepatocellular Carcinoma.Sci Rep. 2017 Aug 30;7(1):10049. doi: 10.1038/s41598-017-10365-3.
27	Reversing effect of sorcin in the drug resistance of human nasopharyngeal carcinoma.Anat Rec (Hoboken). 2014 Feb;297(2):215-21. doi: 10.1002/ar.22832. Epub 2013 Dec 24.
28	Identification of histological markers for malignant glioma by genome-wide expression analysis: dynein, alpha-PIX and sorcin.Acta Neuropathol. 2006 Jan;111(1):29-38. doi: 10.1007/s00401-005-1085-6. Epub 2005 Nov 30.
29	Purification, cDNA cloning, and expression of human sorcin in vincristine-resistant HOB1 lymphoma cell lines.Arch Biochem Biophys. 1996 Jan 15;325(2):217-26. doi: 10.1006/abbi.1996.0027.
30	Sorcin silencing inhibits epithelial-to-mesenchymal transition and suppresses breast cancer metastasis in vivo.Breast Cancer Res Treat. 2014 Jan;143(2):287-99. doi: 10.1007/s10549-013-2809-2. Epub 2013 Dec 15.
31	Disruption of MeCP2 attenuates circadian rhythm in CRISPR/Cas9-based Rett syndrome model mouse.Genes Cells. 2015 Dec;20(12):992-1005. doi: 10.1111/gtc.12305. Epub 2015 Oct 12.
32	Efficacy and safety of low-dose IL-2 in the treatment of systemic lupus erythematosus: a randomised, double-blind, placebo-controlled trial.Ann Rheum Dis. 2020 Jan;79(1):141-149. doi: 10.1136/annrheumdis-2019-215396. Epub 2019 Sep 19.
33	Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
34	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
35	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
36	Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
37	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
38	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
39	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
40	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
41	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
42	DNA microarray analysis of vitamin D-induced gene expression in a human colon carcinoma cell line. Physiol Genomics. 2004 Apr 13;17(2):122-9. doi: 10.1152/physiolgenomics.00002.2003.
43	Ornithine decarboxylase antizyme upregulates DNA-dependent protein kinase and enhances the nonhomologous end-joining repair of DNA double-strand breaks in human oral cancer cells. Biochemistry. 2007 Aug 7;46(31):8920-32. doi: 10.1021/bi7000328. Epub 2007 Jul 14.
44	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
45	Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
46	Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
47	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
48	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
49	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
50	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
51	Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
52	NF-B p65 regulates hepatic lipogenesis by promoting nuclear entry of ChREBP in response to a high carbohydrate diet. J Biol Chem. 2021 Jan-Jun;296:100714. doi: 10.1016/j.jbc.2021.100714. Epub 2021 Apr 27.
53	[Correlation of sorcin overexpression to multidrug resistance of human gastric cancer cell line SGC7901]. Ai Zheng. 2008 Apr;27(4):337-42.
54	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.