Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBE3H07)

• DOT Name: Cyclin-dependent kinase inhibitor 3 (CDKN3)
• Synonyms: EC 3.1.3.16; EC 3.1.3.48; CDK2-associated dual-specificity phosphatase; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; Kinase-associated phosphatase
• Gene Name: CDKN3
• Related Disease:
  Adult glioblastoma
  Carcinoma of liver and intrahepatic biliary tract
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Liver cancer
  Neuroblastoma
  Type-1/2 diabetes
  Acute myelogenous leukaemia
  Advanced cancer
  AIDS-related lymphoma
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Classic Hodgkin lymphoma
  Colon cancer
  Colon carcinoma
  Dental caries
  Epithelial ovarian cancer
  Esophageal cancer
  Glioma
  Kaposi sarcoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Multiple endocrine neoplasia type 1
  Neoplasm
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Retinoblastoma
  Small lymphocytic lymphoma
  Stomach cancer
  Colorectal carcinoma
  Cutaneous melanoma
  Melanoma
  Gastric cancer
  Non-insulin dependent diabetes
  Plasma cell myeloma
  Rheumatoid arthritis
• UniProt ID: CDKN3_HUMAN
• PDB ID: 1FPZ; 1FQ1
• EC Number: 3.1.3.16; 3.1.3.48
• Pfam ID: PF05706
• Sequence:
  MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
  QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
  EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
  QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
• Function: May play a role in cell cycle regulation. Dual specificity CC phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Altered Expression	[1]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Definitive	Altered Expression	[2]
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Altered Expression	[3]
Glioblastoma multiforme	DISK8246	Definitive	Altered Expression	[1]
Liver cancer	DISDE4BI	Definitive	Altered Expression	[2]
Neuroblastoma	DISVZBI4	Definitive	Biomarker	[4]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[5]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[7]
AIDS-related lymphoma	DISSLRAU	Strong	Altered Expression	[8]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[10]
Carcinoma	DISH9F1N	Strong	Posttranslational Modification	[11]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[12]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[13]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[13]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Altered Expression	[14]
Colon cancer	DISVC52G	Strong	Biomarker	[15]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[15]
Dental caries	DISRBCMD	Strong	Genetic Variation	[16]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[17]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[12]
Glioma	DIS5RPEH	Strong	Altered Expression	[18]
Kaposi sarcoma	DISC1H1Z	Strong	Biomarker	[8]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[19]
Lung cancer	DISCM4YA	Strong	Biomarker	[20]
Lung carcinoma	DISTR26C	Strong	Biomarker	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[21]
Multiple endocrine neoplasia type 1	DIS0RJRK	Strong	Genetic Variation	[22]
Neoplasm	DISZKGEW	Strong	Altered Expression	[23]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[12]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[24]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[9]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[17]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[17]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[25]
Prostate cancer	DISF190Y	Strong	Altered Expression	[26]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[27]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[28]
Small lymphocytic lymphoma	DIS30POX	Strong	Genetic Variation	[29]
Stomach cancer	DISKIJSX	Strong	Biomarker	[30]
Colorectal carcinoma	DIS5PYL0	moderate	Altered Expression	[31]
Cutaneous melanoma	DIS3MMH9	moderate	Genetic Variation	[32]
Melanoma	DIS1RRCY	moderate	Genetic Variation	[33]
Gastric cancer	DISXGOUK	Limited	Biomarker	[30]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[34]
Plasma cell myeloma	DIS0DFZ0	Limited	Altered Expression	[35]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[36]

41 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[43]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[44]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[46]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[47]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[48]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[47]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[49]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[43]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[50]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[51]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[52]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[53]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[54]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[55]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[56]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[57]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[58]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[59]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[60]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[48]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[61]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[44]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[62]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[56]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[63]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[48]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[61]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[64]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[65]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[66]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[67]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Cyclin-dependent kinase inhibitor 3 (CDKN3).	[68]

References

• [1] KAP regulates ROCK2 and Cdk2 in an RNA-activated glioblastoma invasion pathway.Oncogene. 2015 Mar 12;34(11):1432-41. doi: 10.1038/onc.2014.49. Epub 2014 Apr 7.
• [2] CDKN3 expression is negatively associated with pathological tumor stage and CDKN3 inhibition promotes cell survival in hepatocellular carcinoma.Mol Med Rep. 2016 Aug;14(2):1509-14. doi: 10.3892/mmr.2016.5410. Epub 2016 Jun 17.
• [3] Pathway analysis of differentially expressed genes in human esophageal squamous cell carcinoma.Eur Rev Med Pharmacol Sci. 2015;19(9):1652-61.
• [4] Cyclin-Dependent Kinase Inhibitor AT7519 as a Potential Drug for MYCN-Dependent Neuroblastoma.Clin Cancer Res. 2015 Nov 15;21(22):5100-9. doi: 10.1158/1078-0432.CCR-15-0313. Epub 2015 Jul 22.
• [5] Knowledge, attitude and practice among non-ophthalmic health care providers regarding eye management of diabetics in private sector of Riyadh, Saudi Arabia.BMC Health Serv Res. 2019 Jun 13;19(1):375. doi: 10.1186/s12913-019-4216-9.
• [6] Hepatic leukemia factor is a novel leukemic stem cell regulator in DNMT3A, NPM1, and FLT3-ITD triple-mutated AML.Blood. 2019 Jul 18;134(3):263-276. doi: 10.1182/blood.2018862383. Epub 2019 May 10.
• [7] Ironing out the role of the cyclin-dependent kinase inhibitor, p21 in cancer: Novel iron chelating agents to target p21 expression and activity.Free Radic Biol Med. 2019 Mar;133:276-294. doi: 10.1016/j.freeradbiomed.2018.03.027. Epub 2018 Mar 20.
• [8] Activated Nrf2 Interacts with Kaposi's Sarcoma-Associated Herpesvirus Latency Protein LANA-1 and Host Protein KAP1 To Mediate Global Lytic Gene Repression.J Virol. 2015 Aug;89(15):7874-92. doi: 10.1128/JVI.00895-15. Epub 2015 May 20.
• [9] Forkhead box M1 regulates the transcriptional network of genes essential for mitotic progression and genes encoding the SCF (Skp2-Cks1) ubiquitin ligase.Mol Cell Biol. 2005 Dec;25(24):10875-94. doi: 10.1128/MCB.25.24.10875-10894.2005.
• [10] Silencing cyclin-dependent kinase inhibitor3 inhibits the migration of breast cancer cell lines.Mol Med Rep. 2016 Aug;14(2):1523-30. doi: 10.3892/mmr.2016.5401. Epub 2016 Jun 14.
• [11] Selective association of the methyl-CpG binding protein MBD2 with the silent p14/p16 locus in human neoplasia.Proc Natl Acad Sci U S A. 2001 Apr 24;98(9):4990-5. doi: 10.1073/pnas.101617298. Epub 2001 Apr 17.
• [12] CDKN3 promotes tumor progression and confers cisplatin resistance via RAD51 in esophageal cancer.Cancer Manag Res. 2019 Apr 15;11:3253-3264. doi: 10.2147/CMAR.S193793. eCollection 2019.
• [13] CDKN3 mRNA as a Biomarker for Survival and Therapeutic Target in Cervical Cancer.PLoS One. 2015 Sep 15;10(9):e0137397. doi: 10.1371/journal.pone.0137397. eCollection 2015.
• [14] Human non-Hodgkin's lymphomas overexpress a wild-type form of p53 which is a functional transcriptional activator of the cyclin-dependent kinase inhibitor p21.Blood. 1997 Apr 1;89(7):2523-8.
• [15] EVI1 targets Np63 and upregulates the cyclin dependent kinase inhibitor p21 independent of p53 to delay cell cycle progression and cell proliferation in colon cancer cells.Int J Biochem Cell Biol. 2013 Aug;45(8):1568-76. doi: 10.1016/j.biocel.2013.04.032. Epub 2013 May 9.
• [16] Genome-wide association scan of dental caries in the permanent dentition.BMC Oral Health. 2012 Dec 21;12:57. doi: 10.1186/1472-6831-12-57.
• [17] CDKN3 knockdown reduces cell proliferation, invasion and promotes apoptosis in human ovarian cancer.Int J Clin Exp Pathol. 2015 May 1;8(5):4535-44. eCollection 2015.
• [18] Anti-proliferative effect of Zea mays L. cob extract on rat C6 glioma cells through regulation of glycolysis, mitochondrial ROS, and apoptosis.Biomed Pharmacother. 2018 Feb;98:726-732. doi: 10.1016/j.biopha.2017.12.115. Epub 2018 Jan 4.
• [19] Overexpression of major CDKN3 transcripts is associated with poor survival in lung adenocarcinoma.Br J Cancer. 2015 Dec 22;113(12):1735-43. doi: 10.1038/bjc.2015.378. Epub 2015 Nov 10.
• [20] KAP1 inhibits the Raf-MEK-ERK pathway to promote tumorigenesis in A549 lung cancer cells.Mol Carcinog. 2018 Oct;57(10):1396-1407. doi: 10.1002/mc.22853. Epub 2018 Jun 22.
• [21] Promoter-associated endogenous and exogenous small RNAs suppress human bladder cancer cell metastasis by activating p21 (CIP1/WAF1) expression.Tumour Biol. 2016 May;37(5):6589-98. doi: 10.1007/s13277-015-4571-z. Epub 2015 Dec 7.
• [22] Multiple endocrine neoplasia type 1 (MEN1) and type 4 (MEN4).Mol Cell Endocrinol. 2014 Apr 5;386(1-2):2-15. doi: 10.1016/j.mce.2013.08.002. Epub 2013 Aug 8.
• [23] Cyclin-Dependent Kinase Inhibitor 3 Promotes Cancer Cell Proliferation and Tumorigenesis in Nasopharyngeal Carcinoma by Targeting p27.Oncol Res. 2017 Nov 2;25(9):1431-1440. doi: 10.3727/096504017X14835311718295. Epub 2017 Jan 20.
• [24] Tumor-suppressive effects of microRNA-181d-5p on non-small-cell lung cancer through the CDKN3-mediated Akt signaling pathway in vivo and in vitro.Am J Physiol Lung Cell Mol Physiol. 2019 May 1;316(5):L918-L933. doi: 10.1152/ajplung.00334.2018. Epub 2019 Jan 10.
• [25] YY1 suppresses proliferation and migration of pancreatic ductal adenocarcinoma by regulating the CDKN3/MdM2/P53/P21 signaling pathway.Int J Cancer. 2018 Apr 1;142(7):1392-1404. doi: 10.1002/ijc.31173. Epub 2017 Dec 4.
• [26] Cyclin-dependent kinase inhibitor 3 (CDKN3) plays a critical role in prostate cancer via regulating cell cycle and DNA replication signaling.Biomed Pharmacother. 2017 Dec;96:1109-1118. doi: 10.1016/j.biopha.2017.11.112. Epub 2017 Nov 28.
• [27] Cyclin-dependent kinase-associated protein phosphatase is overexpressed in alcohol-related hepatocellular carcinoma and influences xenograft tumor growth.Oncol Rep. 2013 Mar;29(3):903-10. doi: 10.3892/or.2012.2208. Epub 2012 Dec 24.
• [28] Novel use of a Clinical Laboratory Improvements Amendments (CLIA)-certified Cyclin-Dependent Kinase N2C (CDKN2C) loss assay insporadic medullary thyroid carcinoma.Surgery. 2020 Jan;167(1):80-86. doi: 10.1016/j.surg.2019.03.041. Epub 2019 Oct 21.
• [29] Cyclin-Dependent Kinase Inhibitor P1446A Induces Apoptosis in a JNK/p38 MAPK-Dependent Manner in Chronic Lymphocytic Leukemia B-Cells.PLoS One. 2015 Nov 25;10(11):e0143685. doi: 10.1371/journal.pone.0143685. eCollection 2015.
• [30] Knockdown of Cyclin-Dependent Kinase Inhibitor 3 Inhibits Proliferation and Invasion in Human Gastric Cancer Cells.Oncol Res. 2017 May 24;25(5):721-731. doi: 10.3727/096504016X14772375848616. Epub 2016 Oct 27.
• [31] Phenylethynyl-substituted Heterocycles Inhibit Cyclin D1 and Induce the Expression of Cyclin-dependent Kinase Inhibitor p21(Wif1/Cip1) in Colorectal Cancer Cells.Medchemcomm. 2018;9(1):87-99. doi: 10.1039/C7MD00393E. Epub 2017 Nov 3.
• [32] Screening of germline mutations in the CDK4, CDKN2C and TP53 genes in familial melanoma: a clinic-based population study.Int J Cancer. 1998 Sep 25;78(1):13-5. doi: 10.1002/(sici)1097-0215(19980925)78:1<13::aid-ijc3>3.0.co;2-#.
• [33] MC1R genotype modifies risk of melanoma in families segregating CDKN2A mutations.Am J Hum Genet. 2001 Oct;69(4):765-73. doi: 10.1086/323412. Epub 2001 Aug 8.
• [34] Expression profiling of cell cycle genes in human pancreatic islets with and without type 2 diabetes.Mol Cell Endocrinol. 2013 Aug 15;375(1-2):35-42. doi: 10.1016/j.mce.2013.05.003. Epub 2013 May 22.
• [35] Oncogene-induced senescence: a potential breakpoint mechanism against malignant transformation in plasma cell disorders.Leuk Lymphoma. 2018 Nov;59(11):2660-2669. doi: 10.1080/10428194.2018.1443450. Epub 2018 Apr 4.
• [36] Direct modulation of rheumatoid inflammatory mediator expression in retinoblastoma protein-dependent and -independent pathways by cyclin-dependent kinase 4/6.Arthritis Rheum. 2006 Jul;54(7):2074-83. doi: 10.1002/art.21927.
• [37] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [38] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [39] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [40] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [41] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [44] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [45] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [46] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [47] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [48] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [49] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [50] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [51] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [52] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [53] Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
• [54] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [55] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [56] Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
• [57] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [58] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [59] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [60] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [61] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [62] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [63] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [64] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [65] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [66] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [67] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [68] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.