Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC6VB4K)

DOT Name Mothers against decapentaplegic homolog 2 (SMAD2)
Synonyms MAD homolog 2; Mothers against DPP homolog 2; JV18-1; Mad-related protein 2; hMAD-2; SMAD family member 2; SMAD 2; Smad2; hSMAD2
Gene Name SMAD2
Related Disease
Atrial fibrillation ( )
Congenital heart disease ( )
Acromicric dysplasia ( )
Advanced cancer ( )
Asthma ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Chronic obstructive pulmonary disease ( )
Clear cell renal carcinoma ( )
Colon carcinoma ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Gastric cancer ( )
Geleophysic dysplasia ( )
Glioblastoma multiforme ( )
Glioma ( )
Liver cancer ( )
Loeys-Dietz syndrome ( )
Loeys-Dietz syndrome 6 ( )
Lung adenocarcinoma ( )
Lung carcinoma ( )
Matthew-Wood syndrome ( )
Metastatic malignant neoplasm ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Osteosarcoma ( )
Pancreatic cancer ( )
Pulmonary fibrosis ( )
Renal cell carcinoma ( )
Squamous cell carcinoma ( )
Systemic sclerosis ( )
Type-1/2 diabetes ( )
Chronic kidney disease ( )
Colon cancer ( )
Diabetic kidney disease ( )
Familial thoracic aortic aneurysm and aortic dissection ( )
Myocardial infarction ( )
Stomach cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Adult glioblastoma ( )
Congenital heart defects, multiple types, 8, with or without heterotaxy ( )
Endometrial cancer ( )
Esophageal squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Neuroblastoma ( )
Retinoblastoma ( )
Triple negative breast cancer ( )
UniProt ID
SMAD2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1DEV; 1KHX; 1U7V; 2LB3; 5XOD; 5ZOJ; 6M64; 6YIA; 6ZVQ; 7CO1
Pfam ID
PF03165 ; PF03166
Sequence
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
Function
Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. Promotes TGFB1-mediated transcription of odontoblastic differentiation genes in dental papilla cells. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. May act as a tumor suppressor in colorectal carcinoma.
Tissue Specificity Expressed at high levels in skeletal muscle, endothelial cells, heart and placenta.
KEGG Pathway
Cell cycle (hsa04110 )
Endocytosis (hsa04144 )
Cellular senescence (hsa04218 )
TGF-beta sig.ling pathway (hsa04350 )
Apelin sig.ling pathway (hsa04371 )
Hippo sig.ling pathway (hsa04390 )
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
Th17 cell differentiation (hsa04659 )
Relaxin sig.ling pathway (hsa04926 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Chagas disease (hsa05142 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Pathways in cancer (hsa05200 )
Proteoglycans in cancer (hsa05205 )
Colorectal cancer (hsa05210 )
Pancreatic cancer (hsa05212 )
Hepatocellular carcinoma (hsa05225 )
Gastric cancer (hsa05226 )
Inflammatory bowel disease (hsa05321 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Signaling by Activin (R-HSA-1502540 )
Downregulation of TGF-beta receptor signaling (R-HSA-2173788 )
TGF-beta receptor signaling activates SMADs (R-HSA-2173789 )
Downregulation of SMAD2/3 (R-HSA-2173795 )
SMAD2/SMAD3 (R-HSA-2173796 )
SMAD2/3 Phosphorylation Motif Mutants in Cancer (R-HSA-3304356 )
SMAD4 MH2 Domain Mutants in Cancer (R-HSA-3311021 )
SMAD2/3 MH2 Domain Mutants in Cancer (R-HSA-3315487 )
TGFBR1 KD Mutants in Cancer (R-HSA-3656532 )
Transcriptional regulation of pluripotent stem cells (R-HSA-452723 )
Ub-specific processing proteases (R-HSA-5689880 )
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017 )
FOXO-mediated transcription of cell cycle genes (R-HSA-9617828 )
Germ layer formation at gastrulation (R-HSA-9754189 )
Formation of axial mesoderm (R-HSA-9796292 )
Formation of definitive endoderm (R-HSA-9823730 )
Signaling by NODAL (R-HSA-1181150 )

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Atrial fibrillation DIS15W6U Definitive Biomarker [1]
Congenital heart disease DISQBA23 Definitive Autosomal dominant [2]
Acromicric dysplasia DISMV8M7 Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Asthma DISW9QNS Strong Altered Expression [5]
Bone osteosarcoma DIST1004 Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Altered Expression [7]
Breast carcinoma DIS2UE88 Strong Altered Expression [7]
Chronic obstructive pulmonary disease DISQCIRF Strong Biomarker [8]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [9]
Colon carcinoma DISJYKUO Strong Biomarker [10]
Endometrial carcinoma DISXR5CY Strong Biomarker [11]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [12]
Gastric cancer DISXGOUK Strong Altered Expression [13]
Geleophysic dysplasia DISZOO1G Strong Biomarker [3]
Glioblastoma multiforme DISK8246 Strong Biomarker [14]
Glioma DIS5RPEH Strong Biomarker [14]
Liver cancer DISDE4BI Strong Biomarker [15]
Loeys-Dietz syndrome DIS4FUPZ Strong Autosomal dominant [16]
Loeys-Dietz syndrome 6 DIS2HBWW Strong Autosomal dominant [17]
Lung adenocarcinoma DISD51WR Strong Altered Expression [18]
Lung carcinoma DISTR26C Strong Genetic Variation [19]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [20]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [21]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [22]
Osteoarthritis DIS05URM Strong Altered Expression [23]
Osteosarcoma DISLQ7E2 Strong Biomarker [6]
Pancreatic cancer DISJC981 Strong Biomarker [24]
Pulmonary fibrosis DISQKVLA Strong Biomarker [25]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [9]
Squamous cell carcinoma DISQVIFL Strong Posttranslational Modification [26]
Systemic sclerosis DISF44L6 Strong Genetic Variation [27]
Type-1/2 diabetes DISIUHAP Strong Biomarker [28]
Chronic kidney disease DISW82R7 moderate Posttranslational Modification [29]
Colon cancer DISVC52G moderate Biomarker [10]
Diabetic kidney disease DISJMWEY moderate Genetic Variation [30]
Familial thoracic aortic aneurysm and aortic dissection DIS069FB Moderate Autosomal dominant [2]
Myocardial infarction DIS655KI moderate Altered Expression [31]
Stomach cancer DISKIJSX moderate Altered Expression [13]
Prostate cancer DISF190Y Disputed Biomarker [32]
Prostate carcinoma DISMJPLE Disputed Biomarker [32]
Adult glioblastoma DISVP4LU Limited Biomarker [14]
Congenital heart defects, multiple types, 8, with or without heterotaxy DISRV5T3 Limited Autosomal dominant [33]
Endometrial cancer DISW0LMR Limited Biomarker [11]
Esophageal squamous cell carcinoma DIS5N2GV Limited Altered Expression [34]
Hepatocellular carcinoma DIS0J828 Limited Posttranslational Modification [35]
Neuroblastoma DISVZBI4 Limited Posttranslational Modification [36]
Retinoblastoma DISVPNPB Limited Biomarker [37]
Triple negative breast cancer DISAMG6N Limited Biomarker [38]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Mitoxantrone DMM39BF Approved Mothers against decapentaplegic homolog 2 (SMAD2) affects the response to substance of Mitoxantrone. [67]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Mothers against decapentaplegic homolog 2 (SMAD2). [39]
Etoposide DMNH3PG Approved Etoposide increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [48]
Melphalan DMOLNHF Approved Melphalan increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [48]
Glucosamine DM4ZLFD Approved Glucosamine increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [50]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Mothers against decapentaplegic homolog 2 (SMAD2). [52]
SB-431542 DM0YOXQ Preclinical SB-431542 affects the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [48]
Acteoside DM0YHKB Terminated Acteoside increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [54]
D-glucose DMMG2TO Investigative D-glucose increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [60]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [62]
Uric acid DMA1MKT Investigative Uric acid increases the phosphorylation of Mothers against decapentaplegic homolog 2 (SMAD2). [64]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
24 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [40]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [41]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [42]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [43]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [44]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [45]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [46]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [47]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [46]
Propofol DMB4OLE Approved Propofol decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [49]
Sevoflurane DMC9O43 Approved Sevoflurane increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [49]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [46]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [51]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [40]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [53]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [55]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [56]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [57]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [58]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [59]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [61]
Galangin DM5TQ2O Investigative Galangin increases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [63]
GW-788388 DMIBUW5 Investigative GW-788388 decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [65]
LY2109761 DMAWTG3 Investigative LY2109761 decreases the expression of Mothers against decapentaplegic homolog 2 (SMAD2). [66]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Drug(s)

References

1 CTRP9 Ameliorates Atrial Inflammation, Fibrosis, and Vulnerability to Atrial Fibrillation in Post-Myocardial Infarction Rats.J Am Heart Assoc. 2019 Nov 5;8(21):e013133. doi: 10.1161/JAHA.119.013133. Epub 2019 Oct 18.
2 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3 ADAMTSL2 mutations in geleophysic dysplasia demonstrate a role for ADAMTS-like proteins in TGF-beta bioavailability regulation. Nat Genet. 2008 Sep;40(9):1119-23. doi: 10.1038/ng.199.
4 Tumor-Associated Macrophages Derived TGF-Induced Epithelial to Mesenchymal Transition in Colorectal Cancer Cells through Smad2,3-4/Snail Signaling Pathway.Cancer Res Treat. 2019 Jan;51(1):252-266. doi: 10.4143/crt.2017.613. Epub 2018 Apr 25.
5 Protocatechuic acid inhibits TGF-1-induced proliferation and migration of human airway smooth muscle cells.J Pharmacol Sci. 2019 Jan;139(1):9-14. doi: 10.1016/j.jphs.2018.10.011. Epub 2018 Nov 5.
6 Glaucocalyxin A reverses EMT and TGF-1-induced EMT by inhibiting TGF-1/Smad2/3 signaling pathway in osteosarcoma.Chem Biol Interact. 2019 Jul 1;307:158-166. doi: 10.1016/j.cbi.2019.05.005. Epub 2019 May 4.
7 miR-190 suppresses breast cancer metastasis by regulation of TGF--induced epithelial-mesenchymal transition.Mol Cancer. 2018 Mar 6;17(1):70. doi: 10.1186/s12943-018-0818-9.
8 Cordyceps sinensis inhibits airway remodeling in rats with chronic obstructive pulmonary disease.Exp Ther Med. 2018 Mar;15(3):2731-2738. doi: 10.3892/etm.2018.5777. Epub 2018 Jan 19.
9 Calcitriol inhibits migration and invasion of renal cell carcinoma cells by suppressing Smad2/3-, STAT3- and -catenin-mediated epithelial-mesenchymal transition.Cancer Sci. 2020 Jan;111(1):59-71. doi: 10.1111/cas.14237.
10 Epithelial-mesenchymal transition induced by MyoD inhibits growth of high metastatic colorectal cancer.Med Hypotheses. 2019 Sep;130:109285. doi: 10.1016/j.mehy.2019.109285. Epub 2019 Jun 24.
11 MicroRNA?09 may function as a tumor suppressor in endometrial carcinoma cells by targeting Smad2.Mol Med Rep. 2019 Jan;19(1):622-628. doi: 10.3892/mmr.2018.9642. Epub 2018 Nov 12.
12 Physical interaction of STAT1 isoforms with TGF- receptors leads to functional crosstalk between two signaling pathways in epithelial ovarian cancer.J Exp Clin Cancer Res. 2018 May 11;37(1):103. doi: 10.1186/s13046-018-0773-8.
13 Latent membrane protein 2A inhibits expression level of Smad2 through regulating miR-155-5p in EBV-associated gastric cancer cell lines.J Med Virol. 2020 Jan;92(1):96-106. doi: 10.1002/jmv.25579. Epub 2019 Sep 18.
14 Identification of novel LncRNA targeting Smad2/PKC signal pathway to negatively regulate malignant progression of glioblastoma.J Cell Physiol. 2020 Apr;235(4):3835-3848. doi: 10.1002/jcp.29278. Epub 2019 Oct 11.
15 GDF11/BMP11 as a novel tumor marker for liver cancer.Exp Ther Med. 2018 Apr;15(4):3495-3500. doi: 10.3892/etm.2018.5861. Epub 2018 Feb 12.
16 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
17 SMAD2 Mutations Are Associated with Arterial Aneurysms and Dissections. Hum Mutat. 2015 Dec;36(12):1145-9. doi: 10.1002/humu.22854. Epub 2015 Sep 10.
18 MDM2 promotes epithelial-mesenchymal transition through activation of Smad2/3 signaling pathway in lung adenocarcinoma.Onco Targets Ther. 2019 Mar 27;12:2247-2258. doi: 10.2147/OTT.S185076. eCollection 2019.
19 The Relationship between Nkx2.1 and DNA Oxidative Damage Repair in Nickel Smelting Workers: Jinchang Cohort Study.Int J Environ Res Public Health. 2019 Jan 4;16(1):120. doi: 10.3390/ijerph16010120.
20 Macrophage-expressed CD51 promotes cancer stem cell properties via the TGF-1/smad2/3 axis in pancreatic cancer.Cancer Lett. 2019 Sep 10;459:204-215. doi: 10.1016/j.canlet.2019.06.005. Epub 2019 Jun 12.
21 NSD2 inhibition suppresses metastasis in cervical cancer by promoting TGF-/TGF-RI/SMADs signaling.Biochem Biophys Res Commun. 2019 Nov 12;519(3):489-496. doi: 10.1016/j.bbrc.2019.08.020. Epub 2019 Sep 14.
22 Overexpression of miR?61?p plays an oncogenic role in human lung adenocarcinoma through the regulation of SMAD2.Int J Oncol. 2019 Jan;54(1):306-314. doi: 10.3892/ijo.2018.4602. Epub 2018 Oct 23.
23 Modulation of TGF?activity by latent TGFbinding protein 1 in human osteoarthritis fibroblastlike synoviocytes.Mol Med Rep. 2018 Jan;17(1):1893-1900. doi: 10.3892/mmr.2017.8086. Epub 2017 Nov 15.
24 Silencing of DLEU2 suppresses pancreatic cancer cell proliferation and invasion by upregulating microRNA-455.Cancer Sci. 2019 May;110(5):1676-1685. doi: 10.1111/cas.13987. Epub 2019 Mar 25.
25 Protective effects of GHK-Cu in bleomycin-induced pulmonary fibrosis via anti-oxidative stress and anti-inflammation pathways.Life Sci. 2020 Jan 15;241:117139. doi: 10.1016/j.lfs.2019.117139. Epub 2019 Dec 4.
26 Epigenetic SMAD3 Repression in Tumor-Associated Fibroblasts Impairs Fibrosis and Response to the Antifibrotic Drug Nintedanib in Lung Squamous Cell Carcinoma.Cancer Res. 2020 Jan 15;80(2):276-290. doi: 10.1158/0008-5472.CAN-19-0637. Epub 2019 Nov 6.
27 Asiatic acid prevents the development of interstitial lung disease in a hypochlorous acid-induced mouse model of scleroderma.Oncol Lett. 2018 Jun;15(6):8711-8716. doi: 10.3892/ol.2018.8412. Epub 2018 Apr 2.
28 Effect of alprostadil on myocardial fibrosis in rats with diabetes mellitus via TGF-1/Smad signaling pathway.Eur Rev Med Pharmacol Sci. 2019 Nov;23(21):9633-9641. doi: 10.26355/eurrev_201911_19457.
29 Nucleotide-Binding Oligomerization Domain-Like Receptor Protein 3 Deficiency in Vascular Smooth Muscle Cells Prevents Arteriovenous Fistula Failure Despite Chronic Kidney Disease.J Am Heart Assoc. 2019 Jan 8;8(1):e011211. doi: 10.1161/JAHA.118.011211.
30 Fibroblast Growth Factor 21 Attenuates Diabetes-Induced Renal Fibrosis by Negatively Regulating TGF--p53-Smad2/3-Mediated Epithelial-to-Mesenchymal Transition via Activation of AKT.Diabetes Metab J. 2020 Feb;44(1):158-172. doi: 10.4093/dmj.2018.0235. Epub 2019 Oct 28.
31 Downregulated microRNA-224 aggravates vulnerable atherosclerotic plaques and vascular remodeling in acute coronary syndrome through activation of the TGF-/Smad pathway.J Cell Physiol. 2019 Mar;234(3):2537-2551. doi: 10.1002/jcp.26945. Epub 2018 Oct 14.
32 Androgen receptor reverses the oncometabolite R-2-hydroxyglutarate-induced prostate cancer cell invasion via suppressing the circRNA-51217/miRNA-646/TGF1/p-Smad2/3 signaling.Cancer Lett. 2020 Mar 1;472:151-164. doi: 10.1016/j.canlet.2019.12.014. Epub 2019 Dec 14.
33 Reduced NODAL signaling strength via mutation of several pathway members including FOXH1 is linked to human heart defects and holoprosencephaly. Am J Hum Genet. 2008 Jul;83(1):18-29. doi: 10.1016/j.ajhg.2008.05.012. Epub 2008 Jun 5.
34 Enhanced Expression of miR-425 Promotes Esophageal Squamous Cell Carcinoma Tumorigenesis by Targeting SMAD2.J Genet Genomics. 2015 Nov 20;42(11):601-611. doi: 10.1016/j.jgg.2015.09.010. Epub 2015 Oct 9.
35 Induction of tolerogenic dendritic cells by activated TGF-/Akt/Smad2 signaling in RIG-I-deficient stemness-high human liver cancer cells.BMC Cancer. 2019 May 14;19(1):439. doi: 10.1186/s12885-019-5670-9.
36 TGFR1 Blockade with Galunisertib (LY2157299) Enhances Anti-Neuroblastoma Activity of the Anti-GD2 Antibody Dinutuximab (ch14.18) with Natural Killer Cells.Clin Cancer Res. 2017 Feb 1;23(3):804-813. doi: 10.1158/1078-0432.CCR-16-1743. Epub 2016 Oct 10.
37 ACVR1C/SMAD2 signaling promotes invasion and growth in retinoblastoma.Oncogene. 2019 Mar;38(12):2056-2075. doi: 10.1038/s41388-018-0543-2. Epub 2018 Nov 6.
38 Activating Transcription Factor 4 Modulates TGF-Induced Aggressiveness in Triple-Negative Breast Cancer via SMAD2/3/4 and mTORC2 Signaling.Clin Cancer Res. 2018 Nov 15;24(22):5697-5709. doi: 10.1158/1078-0432.CCR-17-3125. Epub 2018 Jul 16.
39 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
40 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
41 Doxorubicin inhibits TGF-beta signaling in human lung carcinoma A549 cells. Eur J Pharmacol. 2008 Aug 20;590(1-3):67-73. doi: 10.1016/j.ejphar.2008.05.030. Epub 2008 May 29.
42 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
43 Suppression of transforming growth factor beta/smad signaling in keloid-derived fibroblasts by quercetin: implications for the treatment of excessive scars. J Trauma. 2004 Nov;57(5):1032-7. doi: 10.1097/01.ta.0000114087.46566.eb.
44 Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
45 MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
46 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
47 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
48 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
49 The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
50 Glucosamine promotes osteogenic differentiation of dental pulp stem cells through modulating the level of the transforming growth factor-beta type I receptor. J Cell Physiol. 2010 Oct;225(1):140-51.
51 Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
52 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
53 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
54 Acteoside inhibits human promyelocytic HL-60 leukemia cell proliferation via inducing cell cycle arrest at G0/G1 phase and differentiation into monocyte. Carcinogenesis. 2007 Sep;28(9):1928-36. doi: 10.1093/carcin/bgm126. Epub 2007 Jul 18.
55 Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
56 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
57 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
58 Ochratoxin A induces epithelial-to-mesenchymal transition and renal fibrosis through TGF-/Smad2/3 and Wnt1/-catenin signaling pathways in vitro and in vivo. Arch Toxicol. 2020 Sep;94(9):3329-3342. doi: 10.1007/s00204-020-02829-9. Epub 2020 Jul 2.
59 [The role of transforming growth factor-(1)/connective tissue growth factor signaling pathway in paraquat-induced pulmonary fibrosis]. Zhonghua Lao Dong Wei Sheng Zhi Ye Bing Za Zhi. 2016 Jul 20;34(7):484-488. doi: 10.3760/cma.j.issn.1001-9391.2016.07.002.
60 Isoangustone A suppresses mesangial fibrosis and inflammation in human renal mesangial cells. Exp Biol Med (Maywood). 2011 Apr 1;236(4):435-44. doi: 10.1258/ebm.2010.010325. Epub 2011 Mar 2.
61 Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.
62 AhR ligands reactivate LINE-1 retrotransposon in triple-negative breast cancer cells MDA-MB-231 and non-tumorigenic mammary epithelial cells NMuMG. Biochem Pharmacol. 2020 May;175:113904. doi: 10.1016/j.bcp.2020.113904. Epub 2020 Mar 8.
63 Galangin suppresses HepG2 cell proliferation by activating the TGF- receptor/Smad pathway. Toxicology. 2014 Dec 4;326:9-17. doi: 10.1016/j.tox.2014.09.010. Epub 2014 Sep 28.
64 TGF- is elevated in hyperuricemic individuals and mediates urate-induced hyperinflammatory phenotype in human mononuclear cells. Arthritis Res Ther. 2023 Feb 27;25(1):30. doi: 10.1186/s13075-023-03001-1.
65 T-2 toxin induces articular cartilage damage by increasing the expression of MMP-13 via the TGF- receptor pathway. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221075555. doi: 10.1177/09603271221075555.
66 In vitro and ex vivo anti-fibrotic effects of LY2109761, a small molecule inhibitor against TGF-. Toxicol Appl Pharmacol. 2018 Sep 15;355:127-137. doi: 10.1016/j.taap.2018.07.001. Epub 2018 Jul 3.
67 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.