Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCZSREH)

• DOT Name: Rab9 effector protein with kelch motifs (RABEPK)
• Synonyms: 40 kDa Rab9 effector protein; p40
• Gene Name: RABEPK
• Related Disease:
  Colorectal carcinoma
  Ductal breast carcinoma in situ
  Abdominal aortic aneurysm
  Adenoma
  Advanced cancer
  Alzheimer disease
  Autoimmune disease
  Breast cancer
  Carcinoma
  Dementia
  Ewing sarcoma
  Hepatitis C virus infection
  Hepatocellular carcinoma
  HIV infectious disease
  Immunodeficiency
  Inflammatory bowel disease
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Multiple sclerosis
  Mycobacterium infection
  Nervous system inflammation
  Non-hodgkin lymphoma
  Non-small-cell lung cancer
  Osteoarthritis
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Pulmonary disease
  Rheumatoid arthritis
  Systemic lupus erythematosus
  Tuberculosis
  Ulcerative colitis
  Ankylosing spondylitis
  Arteriosclerosis
  Atherosclerosis
  Breast carcinoma
  Type-1/2 diabetes
  Malaria
  Arthritis
  Asthma
  Atopic dermatitis
  Colitis
  Neoplasm
  Small-cell lung cancer
  Type-1 diabetes
• UniProt ID: RABEK_HUMAN
• Pfam ID: PF01344 ; PF07646 ; PF13415
• Sequence:
  MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNR
  SFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLN
  PETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTW
  SQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAP
  AGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCI
  IPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEG
  EIYDDCIVTVVD
• Function: Rab9 effector required for endosome to trans-Golgi network (TGN) transport.
• Reactome Pathway: Retrograde transport at the Trans-Golgi-Network (R-HSA-6811440)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Ductal breast carcinoma in situ	DISLCJY7	Definitive	Altered Expression	[2]
Abdominal aortic aneurysm	DISD06OF	Strong	Biomarker	[3]
Adenoma	DIS78ZEV	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Autoimmune disease	DISORMTM	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[9]
Dementia	DISXL1WY	Strong	Biomarker	[6]
Ewing sarcoma	DISQYLV3	Strong	Altered Expression	[10]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
HIV infectious disease	DISO97HC	Strong	Genetic Variation	[13]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[14]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[15]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[16]
Lung cancer	DISCM4YA	Strong	Biomarker	[17]
Lung carcinoma	DISTR26C	Strong	Biomarker	[18]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[19]
Mycobacterium infection	DISNSMUD	Strong	Genetic Variation	[20]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[21]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Altered Expression	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[23]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[24]
Prostate cancer	DISF190Y	Strong	Altered Expression	[5]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[5]
Psoriasis	DIS59VMN	Strong	Biomarker	[25]
Pulmonary disease	DIS6060I	Strong	Altered Expression	[26]
Rheumatoid arthritis	DISTSB4J	Strong	Altered Expression	[24]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[7]
Tuberculosis	DIS2YIMD	Strong	Altered Expression	[27]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[28]
Ankylosing spondylitis	DISRC6IR	moderate	Biomarker	[24]
Arteriosclerosis	DISK5QGC	moderate	Genetic Variation	[29]
Atherosclerosis	DISMN9J3	moderate	Genetic Variation	[29]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[2]
Type-1/2 diabetes	DISIUHAP	moderate	Genetic Variation	[29]
Malaria	DISQ9Y50	Disputed	Biomarker	[30]
Arthritis	DIST1YEL	Limited	Biomarker	[31]
Asthma	DISW9QNS	Limited	Altered Expression	[32]
Atopic dermatitis	DISTCP41	Limited	Biomarker	[33]
Colitis	DISAF7DD	Limited	Altered Expression	[34]
Neoplasm	DISZKGEW	Limited	Biomarker	[35]
Small-cell lung cancer	DISK3LZD	Limited	Altered Expression	[36]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[37]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cycloheximide	DMGDA3C	Investigative	Rab9 effector protein with kelch motifs (RABEPK) affects the response to substance of Cycloheximide.	[51]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Rab9 effector protein with kelch motifs (RABEPK).	[38]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[42]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[44]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[45]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[46]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[47]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[48]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Rab9 effector protein with kelch motifs (RABEPK).	[50]

References

• [1] Role of anthocyanin-enriched purple-fleshed sweet potato p40 in colorectal cancer prevention.Mol Nutr Food Res. 2013 Nov;57(11):1908-17. doi: 10.1002/mnfr.201300040. Epub 2013 Jun 19.
• [2] Evaluation of p40 as a Myoepithelial Marker in Different Breast Lesions.Pathobiology. 2015 Sep;82(3-4):166-71. doi: 10.1159/000375127. Epub 2015 Aug 31.
• [3] Interleukin-12 and -23 blockade mitigates elastase-induced abdominal aortic aneurysm.Sci Rep. 2019 Jul 18;9(1):10447. doi: 10.1038/s41598-019-46909-y.
• [4] Investigation of IL-23 (p19, p40) and IL-23R identifies nuclear expression of IL-23 p19 as a favorable prognostic factor in colorectal cancer: a retrospective multicenter study of 675 patients.Oncotarget. 2014 Jul 15;5(13):4671-82. doi: 10.18632/oncotarget.2069.
• [5] Selective neutralization of IL-12 p40 monomer induces death in prostate cancer cells via IL-12-IFN-.Proc Natl Acad Sci U S A. 2017 Oct 24;114(43):11482-11487. doi: 10.1073/pnas.1705536114. Epub 2017 Oct 9.
• [6] Reduced cerebrospinal fluid concentration of interleukin-12/23 subunit p40 in patients with cognitive impairment.PLoS One. 2017 May 2;12(5):e0176760. doi: 10.1371/journal.pone.0176760. eCollection 2017.
• [7] High Prevalence and Disease Correlation of Autoantibodies Against p40 Encoded by Long Interspersed Nuclear Elements in Systemic Lupus Erythematosus.Arthritis Rheumatol. 2020 Jan;72(1):89-99. doi: 10.1002/art.41054.
• [8] Comparative expression of the LINE-1 p40 protein in human breast carcinomas and normal breast tissues.Oncol Res. 1996;8(6):239-47.
• [9] RETRACTED ARTICLE: Cervical adenosquamous carcinoma: detailed analysis of morphology, immunohistochemical profile, and clinical outcomes in 59 cases.Mod Pathol. 2019 Feb;32(2):269-279. doi: 10.1038/s41379-018-0123-6. Epub 2018 Sep 26.
• [10] Adamantinoma-like Ewing Sarcoma of the Salivary Glands: A Newly Recognized Mimicker of Basaloid Salivary Carcinomas.Am J Surg Pathol. 2019 Feb;43(2):187-194. doi: 10.1097/PAS.0000000000001171.
• [11] Impaired allostimulatory capacity of peripheral blood dendritic cells recovered from hepatitis C virus-infected individuals.J Immunol. 1999 May 1;162(9):5584-91.
• [12] PTK2 and EIF3S3 genes may be amplification targets at 8q23-q24 and are associated with large hepatocellular carcinomas.Hepatology. 2003 Nov;38(5):1242-9. doi: 10.1053/jhep.2003.50457.
• [13] Disruption of MAP kinase activation and nuclear factor binding to the IL-12 p40 promoter in HIV-infected myeloid cells.Clin Exp Immunol. 2004 Aug;137(2):329-40. doi: 10.1111/j.1365-2249.2004.02513.x.
• [14] Molecular analysis of decreased interleukin-12 production in persons infected with human immunodeficiency virus.J Infect Dis. 1996 Jul;174(1):46-53. doi: 10.1093/infdis/174.1.46.
• [15] Allergic and Immunologic Perspectives of Inflammatory Bowel Disease.Clin Rev Allergy Immunol. 2019 Oct;57(2):179-193. doi: 10.1007/s12016-018-8690-3.
• [16] CDX-2 Expression in Primary Lung Adenocarcinoma.Appl Immunohistochem Mol Morphol. 2016 Jan;24(1):16-9. doi: 10.1097/PAI.0000000000000250.
• [17] Mucin staining is of limited value in addition to basic immunohistochemical analyses in the diagnostics of non-small cell lung cancer.Sci Rep. 2019 Feb 4;9(1):1319. doi: 10.1038/s41598-018-37722-0.
• [18] Biomarkers in the diagnosis of pleural diseases: a 2018 update.Ther Adv Respir Dis. 2018 Jan-Dec;12:1753466618808660. doi: 10.1177/1753466618808660.
• [19] Meta-analysis of the IL23R and IL12B polymorphisms in multiple sclerosis.Int J Neurosci. 2016;126(3):205-12. doi: 10.3109/00207454.2015.1007508. Epub 2015 Jun 16.
• [20] Chronic Disseminated Salmonellosis in a Patient With Interleukin-12p40 Deficiency.Pediatr Infect Dis J. 2018 Jan;37(1):90-93. doi: 10.1097/INF.0000000000001701.
• [21] Silencing c-Rel in macrophages dampens Th1 and Th17 immune responses and alleviates experimental autoimmune encephalomyelitis in mice.Immunol Cell Biol. 2017 Aug;95(7):593-600. doi: 10.1038/icb.2017.11. Epub 2017 Feb 16.
• [22] Th1/Th2 cytokine expression and its relationship with tumor growth in B cell non-Hodgkin's lymphoma (NHL).Leuk Lymphoma. 2002 Jun;43(6):1313-21. doi: 10.1080/10428190290026385.
• [23] Non-small cell lung carcinoma with diffuse coexpression of thyroid transcription factor-1 and Np63/p40.Hum Pathol. 2018 Aug;78:177-181. doi: 10.1016/j.humpath.2018.01.023. Epub 2018 Feb 2.
• [24] IL-17A induces osteoblast differentiation by activating JAK2/STAT3 in ankylosing spondylitis.Arthritis Res Ther. 2018 Jun 7;20(1):115. doi: 10.1186/s13075-018-1582-3.
• [25] Anti-IL-12/IL-23p40 antibody ameliorates dermatitis and skin barrier dysfunction in mice with imiquimod-induced psoriasis-like dermatitis.Eur J Pharmacol. 2018 Jun 5;828:26-30. doi: 10.1016/j.ejphar.2018.03.018. Epub 2018 Mar 12.
• [26] Interleukin 23/interleukin 17 axis activated by Mycobacterium avium complex (MAC) is attenuated in patients with MAC-lung disease.Tuberculosis (Edinb). 2018 May;110:7-14. doi: 10.1016/j.tube.2018.03.001. Epub 2018 Mar 3.
• [27] Mycobacterium tuberculosis PPE44 (Rv2770c) is involved in response to multiple stresses and promotes the macrophage expression of IL-12 p40 and IL-6 via the p38, ERK, and NF-B signaling axis.Int Immunopharmacol. 2017 Sep;50:319-329. doi: 10.1016/j.intimp.2017.06.028. Epub 2017 Jul 22.
• [28] Expert opinion on interleukin-12/23 and interleukin-23 antagonists as potential therapeutic options for the treatment of inflammatory bowel disease.Expert Opin Investig Drugs. 2019 May;28(5):473-479. doi: 10.1080/13543784.2019.1597053. Epub 2019 Mar 26.
• [29] Polymorphism of the 3'-untranslated region of interleukin-12 p40 gene is not associated with the presence or severity of coronary artery disease.Circ J. 2005 Jul;69(7):793-7. doi: 10.1253/circj.69.793.
• [30] A replication study of the association between the IL12B promoter allele CTCTAA and susceptibility to cerebral malaria in Thai population.Malar J. 2009 Dec 11;8:290. doi: 10.1186/1475-2875-8-290.
• [31] Divergent effects of IL-12 and IL-23 on the production of IL-17 by human T cells.Eur J Immunol. 2006 Mar;36(3):661-70. doi: 10.1002/eji.200535239.
• [32] Associations of the IL12B promoter polymorphism in longitudinal data from asthmatic patients 7 to 42 years of age.J Allergy Clin Immunol. 2004 Mar;113(3):475-81. doi: 10.1016/j.jaci.2003.10.043.
• [33] Ustekinumab treatment in severe atopic dermatitis: Down-regulation of T-helper 2/22 expression.J Am Acad Dermatol. 2017 Jan;76(1):91-97.e3. doi: 10.1016/j.jaad.2016.07.047. Epub 2016 Oct 13.
• [34] Production of a Functional Factor, p40, by Lactobacillus rhamnosus GG Is Promoted by Intestinal Epithelial Cell-Secreted Extracellular Vesicles.Infect Immun. 2019 Jun 20;87(7):e00113-19. doi: 10.1128/IAI.00113-19. Print 2019 Jul.
• [35] American Registry of Pathology Expert Opinions: Evaluation of poorly differentiated malignant neoplasms on limited samples - Gastrointestinal mucosal biopsies.Ann Diagn Pathol. 2020 Feb;44:151419. doi: 10.1016/j.anndiagpath.2019.151419. Epub 2019 Nov 15.
• [36] P40 expression in small cell lung cancer: The presence of p40-positive cells does not always indicate squamous differentiation.Thorac Cancer. 2019 May;10(5):1188-1192. doi: 10.1111/1759-7714.13062. Epub 2019 Apr 7.
• [37] Alleles of the IL12B 3'UTR associate with late onset of type 1 diabetes.Hum Immunol. 2004 Dec;65(12):1432-6. doi: 10.1016/j.humimm.2004.09.001.
• [38] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [39] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [40] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [41] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
• [48] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [49] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [50] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [51] Population-based in vitro hazard and concentration-response assessment of chemicals: the 1000 genomes high-throughput screening study. Environ Health Perspect. 2015 May;123(5):458-66. doi: 10.1289/ehp.1408775. Epub 2015 Jan 13.