Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE2OBM4)

• DOT Name: ETS translocation variant 5 (ETV5)
• Synonyms: Ets-related protein ERM
• Gene Name: ETV5
• Related Disease:
  Advanced cancer
  B-cell neoplasm
  Chondrosarcoma
  Autoimmune disease
  B-cell lymphoma
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Colorectal carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Epithelial ovarian cancer
  Herpes simplex infection
  Inflammatory bowel disease
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Malignant soft tissue neoplasm
  Melanoma
  Metastatic malignant neoplasm
  Neoplasm
  Neurofibromatosis type 2
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Prostate cancer
  Sarcoma
  Small lymphocytic lymphoma
  Thyroid gland papillary carcinoma
  Bone osteosarcoma
  Brain neoplasm
  High blood pressure
  Obesity
  Osteosarcoma
  Adult lymphoma
  Bladder cancer
  Leukemia
  Lung adenocarcinoma
  Lymphoma
  Neuroblastoma
  Pediatric lymphoma
  Prostate carcinoma
  Prostate neoplasm
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: ETV5_HUMAN
• PDB ID: 4UNO; 5ILV
• Pfam ID: PF00178 ; PF04621
• Sequence:
  MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
  AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNY
  CAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHS
  LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNR
  PSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
  VDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
  PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
  KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDT
  LPLTHFEDSPAYLLDMDRCSSLPYAEGFAY
• Function: Binds to DNA sequences containing the consensus nucleotide core sequence 5'-GGAA.-3'.
• Tissue Specificity: Ubiquitous.
• KEGG Pathway:
  Transcriptio.l misregulation in cancer (hsa05202)
  Prostate cancer (hsa05215)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
B-cell neoplasm	DISVY326	Definitive	Biomarker	[2]
Chondrosarcoma	DIS4I7JB	Definitive	Biomarker	[3]
Autoimmune disease	DISORMTM	Strong	Biomarker	[4]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[5]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[11]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[12]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[13]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Lung neoplasm	DISVARNB	Strong	Biomarker	[15]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Genetic Variation	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Altered Expression	[10]
Neurofibromatosis type 2	DISI8ECS	Strong	Biomarker	[19]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[20]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[20]
Pancreatic cancer	DISJC981	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Altered Expression	[22]
Sarcoma	DISZDG3U	Strong	Genetic Variation	[16]
Small lymphocytic lymphoma	DIS30POX	Strong	Genetic Variation	[23]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[24]
Bone osteosarcoma	DIST1004	moderate	Altered Expression	[25]
Brain neoplasm	DISY3EKS	moderate	Altered Expression	[26]
High blood pressure	DISY2OHH	moderate	Genetic Variation	[27]
Obesity	DIS47Y1K	moderate	Genetic Variation	[6]
Osteosarcoma	DISLQ7E2	moderate	Altered Expression	[25]
Adult lymphoma	DISK8IZR	Limited	Genetic Variation	[23]
Bladder cancer	DISUHNM0	Limited	Biomarker	[28]
Leukemia	DISNAKFL	Limited	Biomarker	[29]
Lung adenocarcinoma	DISD51WR	Limited	Altered Expression	[30]
Lymphoma	DISN6V4S	Limited	Genetic Variation	[23]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[31]
Pediatric lymphoma	DIS51BK2	Limited	Genetic Variation	[23]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[22]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[32]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[28]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[28]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of ETS translocation variant 5 (ETV5).	[33]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of ETS translocation variant 5 (ETV5).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of ETS translocation variant 5 (ETV5).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of ETS translocation variant 5 (ETV5).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of ETS translocation variant 5 (ETV5).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of ETS translocation variant 5 (ETV5).	[38]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of ETS translocation variant 5 (ETV5).	[39]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of ETS translocation variant 5 (ETV5).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of ETS translocation variant 5 (ETV5).	[42]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of ETS translocation variant 5 (ETV5).	[43]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of ETS translocation variant 5 (ETV5).	[44]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of ETS translocation variant 5 (ETV5).	[45]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of ETS translocation variant 5 (ETV5).	[46]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of ETS translocation variant 5 (ETV5).	[47]
Rofecoxib	DM3P5DA	Approved	Rofecoxib decreases the expression of ETS translocation variant 5 (ETV5).	[48]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of ETS translocation variant 5 (ETV5).	[49]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of ETS translocation variant 5 (ETV5).	[50]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of ETS translocation variant 5 (ETV5).	[42]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of ETS translocation variant 5 (ETV5).	[51]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of ETS translocation variant 5 (ETV5).	[52]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of ETS translocation variant 5 (ETV5).	[54]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of ETS translocation variant 5 (ETV5).	[55]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of ETS translocation variant 5 (ETV5).	[57]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of ETS translocation variant 5 (ETV5).	[58]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of ETS translocation variant 5 (ETV5).	[59]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR decreases the expression of ETS translocation variant 5 (ETV5).	[60]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of ETS translocation variant 5 (ETV5).	[41]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of ETS translocation variant 5 (ETV5).	[53]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of ETS translocation variant 5 (ETV5).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of ETS translocation variant 5 (ETV5).	[56]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of ETS translocation variant 5 (ETV5).	[41]

References

• [1] ceRNA network analysis reveals prognostic markers for glioblastoma.Oncol Lett. 2019 Jun;17(6):5545-5557. doi: 10.3892/ol.2019.10275. Epub 2019 Apr 18.
• [2] Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.Blood. 2002 Jun 15;99(12):4554-61. doi: 10.1182/blood.v99.12.4554.
• [3] The epigenetic regulation of SOX9 by miR-145 in human chondrosarcoma.J Cell Biochem. 2015 Jan;116(1):37-44. doi: 10.1002/jcb.24940.
• [4] Capicua deficiency induces autoimmunity and promotes follicular helper T cell differentiation via derepression of ETV5.Nat Commun. 2017 Jul 12;8:16037. doi: 10.1038/ncomms16037.
• [5] Identification of Ezrin-Radixin-Moesin proteins as novel regulators of pathogenic B-cell receptor signaling and tumor growth in diffuse large B-cell lymphoma.Leukemia. 2015 Sep;29(9):1857-67. doi: 10.1038/leu.2015.86. Epub 2015 Mar 24.
• [6] Evidence that genes involved in hedgehog signaling are associated with both bipolar disorder and high BMI.Transl Psychiatry. 2019 Nov 21;9(1):315. doi: 10.1038/s41398-019-0652-x.
• [7] Expression of ezrin and moesin in primary breast carcinoma and matched lymph node metastases.Clin Exp Metastasis. 2017 Jun;34(5):333-344. doi: 10.1007/s10585-017-9853-y. Epub 2017 Jun 17.
• [8] Prognostic value of ERM gene expression in human primary breast cancers.Clin Cancer Res. 2004 Nov 1;10(21):7297-303. doi: 10.1158/1078-0432.CCR-04-0593.
• [9] Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma.Mod Pathol. 2009 Sep;22(9):1176-85. doi: 10.1038/modpathol.2009.79. Epub 2009 May 22.
• [10] ETS variant 5 promotes colorectal cancer angiogenesis by targeting platelet-derived growth factor BB.Int J Cancer. 2019 Jul 1;145(1):179-191. doi: 10.1002/ijc.32071. Epub 2019 Jan 28.
• [11] Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.Clin Exp Metastasis. 2015 Jun;32(5):467-78. doi: 10.1007/s10585-015-9720-7. Epub 2015 Apr 30.
• [12] ETV5 transcription factor is overexpressed in ovarian cancer and regulates cell adhesion in ovarian cancer cells.Int J Cancer. 2012 Apr 1;130(7):1532-43. doi: 10.1002/ijc.26148. Epub 2011 Aug 12.
• [13] Structural Basis for the Interaction between p53 Transactivation Domain and the Mediator Subunit MED25.Molecules. 2018 Oct 22;23(10):2726. doi: 10.3390/molecules23102726.
• [14] MicroRNA-219a-5p suppresses intestinal inflammation through inhibiting Th1/Th17-mediated immune responses in inflammatory bowel disease.Mucosal Immunol. 2020 Mar;13(2):303-312. doi: 10.1038/s41385-019-0216-7. Epub 2019 Oct 18.
• [15] A novel member of the NF2/ERM/4.1 superfamily with growth suppressing properties in lung cancer.Cancer Res. 1999 Jan 1;59(1):35-43.
• [16] The utility of ETV1, ETV4 and ETV5 RNA in-situ hybridization in the diagnosis of CIC-DUX sarcomas.Histopathology. 2017 Mar;70(4):657-663. doi: 10.1111/his.13112. Epub 2016 Dec 16.
• [17] ERK/p90(RSK)/14-3-3 signalling has an impact on expression of PEA3 Ets transcription factors via the transcriptional repressor capica.Biochem J. 2011 Feb 1;433(3):515-25. doi: 10.1042/BJ20101562.
• [18] siRNAs target sites selection of ezrin and the influence of RNA interference on ezrin expression and biological characters of osteosarcoma cells.Mol Cell Biochem. 2012 May;364(1-2):363-71. doi: 10.1007/s11010-012-1238-6.
• [19] Childhood neurofibromatosis type 2 (NF2) and related disorders: from bench to bedside and biologically targeted therapies.Acta Otorhinolaryngol Ital. 2016 Oct;36(5):345-367. doi: 10.14639/0392-100X-1093.
• [20] Analysis of gene expression regulated by the ETV5 transcription factor in OV90 ovarian cancer cells identifies FOXM1 overexpression in ovarian cancer.Mol Cancer Res. 2012 Jul;10(7):914-24. doi: 10.1158/1541-7786.MCR-11-0449. Epub 2012 May 15.
• [21] Synthetic 8-hydroxydeoxyguanosine inhibited metastasis of pancreatic cancer through concerted inhibitions of ERM and Rho-GTPase.Free Radic Biol Med. 2017 Sep;110:151-161. doi: 10.1016/j.freeradbiomed.2017.06.003. Epub 2017 Jun 8.
• [22] Strong cytoplasmic ETV1 expression has a negative impact on prostate cancer outcome.Virchows Arch. 2019 Oct;475(4):457-466. doi: 10.1007/s00428-019-02573-1. Epub 2019 Apr 23.
• [23] Berberine reinforces Sertoli cells niche and accelerates spermatogonial stem cells renewal in experimentally-induced varicocele condition in rats.Phytomedicine. 2018 Feb 1;40:68-78. doi: 10.1016/j.phymed.2017.12.036. Epub 2018 Jan 2.
• [24] The Transcription Factor ETV5 Mediates BRAFV600E-Induced Proliferation and TWIST1 Expression in Papillary Thyroid Cancer Cells.Neoplasia. 2018 Nov;20(11):1121-1134. doi: 10.1016/j.neo.2018.09.003. Epub 2018 Sep 25.
• [25] Role of ezrin in osteosarcoma metastasis.Adv Exp Med Biol. 2014;804:181-201. doi: 10.1007/978-3-319-04843-7_10.
• [26] Graph complexity analysis identifies an ETV5 tumor-specific network in human and murine low-grade glioma.PLoS One. 2018 May 22;13(5):e0190001. doi: 10.1371/journal.pone.0190001. eCollection 2018.
• [27] Two obesity susceptibility loci in LYPLAL1 and ETV5 independently associated with childhood hypertension in Chinese population.Gene. 2017 Sep 5;627:284-289. doi: 10.1016/j.gene.2017.06.030. Epub 2017 Jun 20.
• [28] ETV5 links the FGFR3 and Hippo signalling pathways in bladder cancer.Sci Rep. 2019 Apr 5;9(1):5740. doi: 10.1038/s41598-018-36456-3.
• [29] Gene profiling of Graffi murine leukemia virus-induced lymphoid leukemias: identification of leukemia markers and Fmn2 as a potential oncogene.Blood. 2011 Feb 10;117(6):1899-910. doi: 10.1182/blood-2010-10-311001. Epub 2010 Dec 6.
• [30] Altered expression of the ERM proteins in lung adenocarcinoma.Lab Invest. 2000 Nov;80(11):1643-50. doi: 10.1038/labinvest.3780174.
• [31] Activated ALK signals through the ERK-ETV5-RET pathway to drive neuroblastoma oncogenesis.Oncogene. 2018 Mar;37(11):1417-1429. doi: 10.1038/s41388-017-0039-5. Epub 2018 Jan 11.
• [32] An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer.Cell Rep. 2016 Oct 25;17(5):1289-1301. doi: 10.1016/j.celrep.2016.10.001.
• [33] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [34] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [35] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [36] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [39] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [40] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [41] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [42] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [43] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [44] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [45] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [46] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [47] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [48] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [51] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [52] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [53] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [54] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [55] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [56] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [57] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [58] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [59] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [60] Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.