Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEGQ8ZO)

• DOT Name: Ribosome biogenesis protein BMS1 homolog (BMS1)
• Synonyms: Ribosome assembly protein BMS1 homolog
• Gene Name: BMS1
• Related Disease:
  Myocardial infarction
  Non-alcoholic fatty liver disease
  Acute myocardial infarction
  Adrenal adenoma
  Alzheimer disease
  Anorexia nervosa cachexia
  Anxiety
  Arteriosclerosis
  Carcinoma
  Cardiovascular disease
  Colorectal carcinoma
  Congestive heart failure
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Hepatitis C virus infection
  Hepatocellular carcinoma
  High blood pressure
  Lung cancer
  Lung carcinoma
  Major depressive disorder
  Mesothelioma
  Neoplasm
  Non-small-cell lung cancer
  Obsessive compulsive disorder
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Systemic lupus erythematosus
  Triple negative breast cancer
  Tuberculosis
  Adrenocortical carcinoma
  Agenesis of the corpus callosum with peripheral neuropathy
  Gastric cancer
  Metastatic malignant neoplasm
  Stomach cancer
  Aplasia cutis congenita
  Advanced cancer
  Anxiety disorder
  Bipolar disorder
  Chronic kidney disease
  Coronary heart disease
  Corpus callosum, agenesis of
  Malignant pleural mesothelioma
  Non-insulin dependent diabetes
  Obesity
  Type-1/2 diabetes
• UniProt ID: BMS1_HUMAN
• PDB ID: 7MQ9; 7MQA
• Pfam ID: PF08142 ; PF04950
• Sequence:
  MEAKDQKKHRKKNSGPKAAKKKKRLLQDLQLGDEEDARKRNPKAFAVQSAVRMARSFHRT
  QDLKTKKHHIPVVDRTPLEPPPIVVVVMGPPKVGKSTLIQCLIRNFTRQKLTEIRGPVTI
  VSGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMETFEFLNICQVHGFPKIM
  GVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYPGAKLFYLSGMVHGEYQNQEIHNLGRFIT
  VMKFRPLTWQTSHPYILADRMEDLTNPEDIRTNIKCDRKVSLYGYLRGAHLKNKSQIHMP
  GVGDFAVSDISFLPDPCALPEQQKKRCLNEKEKLVYAPLSGVGGVLYDKDAVYVDLGGSH
  VFQDEVGPTHELVQSLISTHSTIDAKMASSRVTLFSDSKPLGSEDIDNQGLMMPKEEKQM
  DLNTGRMRRKAIFGDEDESGDSDDEEDDEMSEDDGLENGSSDEEAEEEENAEMTDQYMAV
  KGIKRRKLELEEDSEMDLPAFADSDDDLERSSAEEGEAEEADESSEEEDCTAGEKGISGS
  KAAGEGSKAGLSPANCQSDRVNLEKSLLMKKAALPTFDSGHCTAEEVFASEDESEESSSL
  SAEEEDSENEEAIRKKLSKPSQVSSGQKLGPQNFIDETSDIENLLKEEEDYKEENNDSKE
  TSGALKWKEDLSRKAAEAFLRQQQAAPNLRKLIYGTVTEDNEEEDDDTLEELGGLFRVNQ
  PDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELY
  GDFEDLETGDVHKGKSGPNTQNEDIEKEVKEEIDPDEEESAKKKHLDKKRKLKEMFDAEY
  DEGESTYFDDLKGEMQKQAQLNRAEFEDQDDEARVQYEGFRPGMYVRIEIENVPCEFVQN
  FDPHYPIILGGLGNSEGNVGYVQMRLKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIE
  DHNGRQRLLKYTPQHMHCGAAFWGPITPQGTGFLAIQSVSGIMPDFRIAATGVVLDLDKS
  IKIVKKLKLTGFPYKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEG
  AFRASFEDKLLMSDIVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTGQLRLAHG
  VRLKANKDSLYKPILRQKKHFNSLHIPKALQKALPFKNKPKTQAKAGKVPKDRRRPAVIR
  EPHERKILALLDALSTVHSQKMKKAKEQRHLHNKEHFRAKQKEEEEKLKRQKDLRKKLFR
  IQGQKERRNQKSSLKGAEGQLQ
• Function: Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome.
• KEGG Pathway: Ribosome biogenesis in eukaryotes (hsa03008)
• Reactome Pathway:
  Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226)
  rRNA modification in the nucleus and cytosol (R-HSA-6790901)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Myocardial infarction	DIS655KI	Definitive	Genetic Variation	[1]
Non-alcoholic fatty liver disease	DISDG1NL	Definitive	Altered Expression	[2]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[3]
Adrenal adenoma	DISC2UN8	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Anorexia nervosa cachexia	DISFO5RQ	Strong	Biomarker	[6]
Anxiety	DISIJDBA	Strong	Biomarker	[7]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Biomarker	[9]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
High blood pressure	DISY2OHH	Strong	Biomarker	[17]
Lung cancer	DISCM4YA	Strong	Biomarker	[18]
Lung carcinoma	DISTR26C	Strong	Biomarker	[18]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[19]
Mesothelioma	DISKWK9M	Strong	Altered Expression	[20]
Neoplasm	DISZKGEW	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[22]
Obsessive compulsive disorder	DIS1ZMM2	Strong	Biomarker	[23]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[13]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Parkinson disease	DISQVHKL	Strong	Biomarker	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[26]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[27]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[28]
Adrenocortical carcinoma	DISZF4HX	moderate	Biomarker	[29]
Agenesis of the corpus callosum with peripheral neuropathy	DISMOV7L	moderate	Genetic Variation	[30]
Gastric cancer	DISXGOUK	moderate	Genetic Variation	[31]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[32]
Stomach cancer	DISKIJSX	moderate	Genetic Variation	[31]
Aplasia cutis congenita	DISMDAYM	Supportive	Autosomal dominant	[33]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[34]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[7]
Bipolar disorder	DISAM7J2	Limited	Altered Expression	[35]
Chronic kidney disease	DISW82R7	Limited	Genetic Variation	[36]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[37]
Corpus callosum, agenesis of	DISO9P40	Limited	Posttranslational Modification	[38]
Malignant pleural mesothelioma	DIST2R60	Limited	Biomarker	[39]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[10]
Obesity	DIS47Y1K	Limited	Biomarker	[40]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[41]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[42]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[44]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[45]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[46]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[47]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[48]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[48]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[52]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ribosome biogenesis protein BMS1 homolog (BMS1).	[53]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Ribosome biogenesis protein BMS1 homolog (BMS1).	[50]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Ribosome biogenesis protein BMS1 homolog (BMS1).	[51]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Ribosome biogenesis protein BMS1 homolog (BMS1).	[51]

References

• [1] XbaI polymorphism in DNA at the apolipoprotein B locus is associated with myocardial infarction (MI).Clin Genet. 1993 Nov;44(5):241-8. doi: 10.1111/j.1399-0004.1993.tb03890.x.
• [2] Active vitamin D supplementation alleviates initiation and progression of nonalcoholic fatty liver disease by repressing the p53 pathway.Life Sci. 2020 Jan 15;241:117086. doi: 10.1016/j.lfs.2019.117086. Epub 2019 Nov 20.
• [3] Factors associated with compliance to AHA/ACC performance measures in a myocardial infarction system of care in Brazil.Int J Qual Health Care. 2017 Aug 1;29(4):499-506. doi: 10.1093/intqhc/mzx059.
• [4] PURE ANDROGEN-PRODUCING ADRENAL TUMOR: CLINICAL FEATURES AND PATHOGENESIS.Endocr Pract. 2017 Apr 2;23(4):399-407. doi: 10.4158/EP161580.OR. Epub 2017 Jan 17.
• [5] Long-Term Extensions of Randomized Vaccination Trials of ACC-001 and QS-21 in Mild to Moderate Alzheimer's Disease.Curr Alzheimer Res. 2017;14(7):696-708. doi: 10.2174/1567205014666170117101537.
• [6] Cortical morphometry in anorexia nervosa: An out-of-sample replication study.Eur Eat Disord Rev. 2019 Sep;27(5):507-520. doi: 10.1002/erv.2686. Epub 2019 Jun 6.
• [7] Chronic harsh parenting and anxiety associations with fear circuitry function in healthy adolescents: A preliminary study.Biol Psychol. 2019 Jul;145:198-210. doi: 10.1016/j.biopsycho.2019.03.019. Epub 2019 Mar 29.
• [8] Development and Validation of Risk Prediction Models for Cardiovascular Events in Black Adults: The Jackson Heart Study Cohort.JAMA Cardiol. 2016 Apr 1;1(1):15-25. doi: 10.1001/jamacardio.2015.0300.
• [9] Expression of MAGE-A1 and MAGE-A3 genes in human salivary gland carcinomas.Chin Med J (Engl). 2003 Jun;116(6):897-900.
• [10] Type 2 diabetes associated variants of KCNQ1 strongly confer the risk of cardiovascular disease among the Saudi Arabian population.Genet Mol Biol. 2017 Jul-Sep;40(3):586-590. doi: 10.1590/1678-4685-GMB-2017-0005. Epub 2017 Aug 31.
• [11] Black Patients with Colorectal Cancer Have More Advanced Cancer Stage at Time of Diagnosis: A Community-Based Safety-Net Hospital Experience.J Community Health. 2017 Aug;42(4):724-729. doi: 10.1007/s10900-016-0309-0.
• [12] What Is New in Heart Failure Management in 2017? Update on ACC/AHA Heart Failure Guidelines.Curr Cardiol Rep. 2018 Apr 17;20(6):39. doi: 10.1007/s11886-018-0978-7.
• [13] Biomarker analysis of the MITO2 phase III trial of first-line treatment in ovarian cancer: predictive value of DNA-PK and phosphorylated ACC.Oncotarget. 2016 Nov 8;7(45):72654-72661. doi: 10.18632/oncotarget.12056.
• [14] Association between the genetic variations within TBX21 gene promoter and the clinicopathological characteristics of esophageal squamous cell carcinoma in a high-risk Chinese population.Tumour Biol. 2015 May;36(5):3985-93. doi: 10.1007/s13277-015-3042-x. Epub 2015 Jan 11.
• [15] Distinct Roles for Intracellular and Extracellular Lipids in Hepatitis C Virus Infection.PLoS One. 2016 Jun 9;11(6):e0156996. doi: 10.1371/journal.pone.0156996. eCollection 2016.
• [16] Inhibition of Acetyl-CoA Carboxylase by Phosphorylation or the Inhibitor ND-654 Suppresses Lipogenesis and Hepatocellular Carcinoma.Cell Metab. 2019 Jan 8;29(1):174-182.e5. doi: 10.1016/j.cmet.2018.08.020. Epub 2018 Sep 20.
• [17] Blood pressure and the new ACC/AHA hypertension guidelines.Trends Cardiovasc Med. 2020 Apr;30(3):160-164. doi: 10.1016/j.tcm.2019.05.003. Epub 2019 May 15.
• [18] Characterization of an 800 kb region at 3p22-p21.3 that was homozygously deleted in a lung cancer cell line.Hum Mol Genet. 1994 Aug;3(8):1341-4. doi: 10.1093/hmg/3.8.1341.
• [19] Neural Basis of the Emotional Conflict Processing in Major Depression: ERPs and Source Localization Analysis on the N450 and P300 Components.Front Hum Neurosci. 2018 May 29;12:214. doi: 10.3389/fnhum.2018.00214. eCollection 2018.
• [20] Highly efficient tumor transduction and antitumor efficacy in experimental human malignant mesothelioma using replicating gibbon ape leukemia virus.Cancer Gene Ther. 2013 Dec;20(12):671-7. doi: 10.1038/cgt.2013.67. Epub 2013 Nov 8.
• [21] Adenoid cystic carcinoma of head and neck: A retrospective clinical analysis of a single institution.Auris Nasus Larynx. 2018 Aug;45(4):831-837. doi: 10.1016/j.anl.2017.10.009. Epub 2018 Apr 10.
• [22] The role of lncRNA MALAT1 in bone metastasis in patients with non-small cell lung cancer.Oncol Rep. 2016 Sep;36(3):1679-85. doi: 10.3892/or.2016.4909. Epub 2016 Jun 29.
• [23] Activation of the orbitofrontal and anterior cingulate cortices during the expression of a naturalistic compulsive-like behavior in the rabbit.Behav Brain Res. 2017 Mar 1;320:67-74. doi: 10.1016/j.bbr.2016.11.022. Epub 2016 Nov 19.
• [24] Postural sway in patients with early Parkinson's disease performing cognitive tasks while standing.Neurol Res. 2018 Jun;40(6):491-498. doi: 10.1080/01616412.2018.1451017. Epub 2018 Jun 5.
• [25] Lipid pathway deregulation in advanced prostate cancer.Pharmacol Res. 2018 May;131:177-184. doi: 10.1016/j.phrs.2018.02.022. Epub 2018 Feb 18.
• [26] Framingham, ACC/AHA or QRISK3: which is the best in systemic lupus erythematosus cardiovascular risk estimation?.Clin Exp Rheumatol. 2020 Jul-Aug;38(4):602-608. Epub 2019 Oct 28.
• [27] Similar outcomes between adenoid cystic carcinoma of the breast and invasive ductal carcinoma: a population-based study from the SEER 18 database.Oncotarget. 2017 Jan 24;8(4):6206-6215. doi: 10.18632/oncotarget.14052.
• [28] Positive epistasis of major low-cost drug resistance mutations rpoB531-TTG and katG315-ACC depends on the phylogenetic background of Mycobacterium tuberculosis strains.Int J Antimicrob Agents. 2017 Jun;49(6):757-762. doi: 10.1016/j.ijantimicag.2017.02.009. Epub 2017 Apr 26.
• [29] Biomolecular engineering of antidehydroepiandrosterone antibodies: a new perspective in cancer diagnosis and treatment using single-chain antibody variable fragment.Nanomedicine (Lond). 2019 Mar;14(6):689-705. doi: 10.2217/nnm-2018-0230. Epub 2019 Jan 29.
• [30] HMSN/ACC truncation mutations disrupt brain-type creatine kinase-dependant activation of K+/Cl- co-transporter 3.Hum Mol Genet. 2008 Sep 1;17(17):2703-11. doi: 10.1093/hmg/ddn172. Epub 2008 Jun 19.
• [31] Association of IL10 gene promoter polymorphisms with risks of gastric cancer and atrophic gastritis.J Int Med Res. 2018 Dec;46(12):5155-5166. doi: 10.1177/0300060518792785. Epub 2018 Sep 11.
• [32] Primary pulmonary adenoid cystic carcinoma: clinicopathological analyses of 12 cases.Int J Clin Exp Pathol. 2015 Jun 1;8(6):7619-26. eCollection 2015.
• [33] BMS1 is mutated in aplasia cutis congenita. PLoS Genet. 2013 Jun;9(6):e1003573. doi: 10.1371/journal.pgen.1003573. Epub 2013 Jun 13.
• [34] Epigallocatechin gallate inhibits the growth of salivary adenoid cystic carcinoma cells via the EGFR/Erk signal transduction pathway and the mitochondria apoptosis pathway.Neoplasma. 2017;64(4):563-570. doi: 10.4149/neo_2017_410.
• [35] Lithium-associated anterior cingulate neurometabolic profile in euthymic Bipolar I disorder: A (1)H-MRS study.J Affect Disord. 2018 Dec 1;241:192-199. doi: 10.1016/j.jad.2018.08.039. Epub 2018 Aug 10.
• [36] KDOQI US Commentary on the 2017 ACC/AHA Hypertension Guideline.Am J Kidney Dis. 2019 Apr;73(4):437-458. doi: 10.1053/j.ajkd.2019.01.007.
• [37] Nonobstructive Coronary Artery Disease by Coronary CT Angiography ImprovesRisk Stratification and Allocationof StatinTherapy.JACC Cardiovasc Imaging. 2017 Sep;10(9):1031-1038. doi: 10.1016/j.jcmg.2016.10.022. Epub 2017 Mar 15.
• [38] Exercise-induced AMPK activation and IL-6 muscle production are disturbed in adiponectin knockout mice.Cytokine. 2019 Jul;119:71-80. doi: 10.1016/j.cyto.2019.03.009. Epub 2019 Mar 20.
• [39] Osteopontin-mediated enhanced hyaluronan binding induces multidrug resistance in mesothelioma cells.Oncogene. 2010 Apr 1;29(13):1941-51. doi: 10.1038/onc.2009.478. Epub 2010 Jan 18.
• [40] Gaps in provider lifestyle counseling and its adherence among obese adults with prediabetes and diabetes in the United States.Prev Med. 2019 Dec;129:105815. doi: 10.1016/j.ypmed.2019.105815. Epub 2019 Aug 24.
• [41] Long-term (5-year) clinical evaluation of the Resolute zotarolimus-eluting coronary stent: The RESOLUTE US clinical trial.Catheter Cardiovasc Interv. 2020 May 1;95(6):1067-1073. doi: 10.1002/ccd.28392. Epub 2019 Jul 13.
• [42] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [43] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [44] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [45] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [46] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [47] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [48] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [49] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [50] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [51] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [52] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [53] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.