Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI71243)

• DOT Name: Protein S100-A10 (S100A10)
• Synonyms: Calpactin I light chain; Calpactin-1 light chain; Cellular ligand of annexin II; S100 calcium-binding protein A10; p10 protein; p11
• Gene Name: S100A10
• Related Disease:
  Acute myelogenous leukaemia
  Chronic renal failure
  End-stage renal disease
  Rheumatoid arthritis
  Adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Clear cell renal carcinoma
  Depression
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Irritable bowel syndrome
  Keloid
  Medulloblastoma
  Melanoma
  Neuroblastoma
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Paracoccidioidomycosis
  Post-traumatic stress disorder
  Promyelocytic leukaemia
  Renal cell carcinoma
  Systemic lupus erythematosus
  Carcinoma
  Metastatic malignant neoplasm
  Mood disorder
  Anxiety
  Anxiety disorder
  Colorectal carcinoma
  Gastric cancer
  Mental disorder
  Neoplasm
  Pancreatic cancer
  Schizophrenia
  Stomach cancer
  Type-1/2 diabetes
• UniProt ID: S10AA_HUMAN
• PDB ID: 1A4P; 1BT6; 4DRW; 4FTG; 4HRE; 4HRG; 4HRH
• Pfam ID: PF01023
• Sequence:
  MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
  QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
• Function: Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
• KEGG Pathway: Salmonella infection (hsa05132)
• Reactome Pathway: Dissolution of Fibrin Clot (R-HSA-75205)

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Definitive	Genetic Variation	[1]
Chronic renal failure	DISGG7K6	Definitive	Biomarker	[2]
End-stage renal disease	DISXA7GG	Definitive	Biomarker	[2]
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[4]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[5]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[6]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[13]
Irritable bowel syndrome	DIS27206	Strong	Altered Expression	[14]
Keloid	DISV09JY	Strong	Biomarker	[15]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Neuroblastoma	DISVZBI4	Strong	Genetic Variation	[7]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[18]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[12]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[12]
Paracoccidioidomycosis	DIS88F55	Strong	Biomarker	[19]
Post-traumatic stress disorder	DISHL1EY	Strong	Altered Expression	[20]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[21]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[10]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[22]
Carcinoma	DISH9F1N	moderate	Altered Expression	[23]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[23]
Mood disorder	DISLVMWO	moderate	Biomarker	[24]
Anxiety	DISIJDBA	Limited	Biomarker	[25]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[25]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[6]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[26]
Mental disorder	DIS3J5R8	Limited	Biomarker	[20]
Neoplasm	DISZKGEW	Limited	Biomarker	[27]
Pancreatic cancer	DISJC981	Limited	Biomarker	[28]
Schizophrenia	DISSRV2N	Limited	Altered Expression	[29]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[26]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[30]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Protein S100-A10 (S100A10) affects the response to substance of Mitomycin.	[64]
PEITC	DMOMN31	Phase 2	Protein S100-A10 (S100A10) affects the binding of PEITC.	[65]

38 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein S100-A10 (S100A10).	[31]
Ciclosporin	DMAZJFX	Approved	Ciclosporin affects the expression of Protein S100-A10 (S100A10).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein S100-A10 (S100A10).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein S100-A10 (S100A10).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein S100-A10 (S100A10).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein S100-A10 (S100A10).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Protein S100-A10 (S100A10).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein S100-A10 (S100A10).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein S100-A10 (S100A10).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Protein S100-A10 (S100A10).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Protein S100-A10 (S100A10).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein S100-A10 (S100A10).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Protein S100-A10 (S100A10).	[43]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Protein S100-A10 (S100A10).	[42]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein S100-A10 (S100A10).	[44]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Protein S100-A10 (S100A10).	[45]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Protein S100-A10 (S100A10).	[46]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Protein S100-A10 (S100A10).	[47]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Protein S100-A10 (S100A10).	[48]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Protein S100-A10 (S100A10).	[43]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Protein S100-A10 (S100A10).	[49]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Protein S100-A10 (S100A10).	[50]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Protein S100-A10 (S100A10).	[51]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Protein S100-A10 (S100A10).	[52]
Adenosine triphosphate	DM79F6G	Approved	Adenosine triphosphate increases the expression of Protein S100-A10 (S100A10).	[53]
Miglitol	DMXBQAM	Approved	Miglitol decreases the expression of Protein S100-A10 (S100A10).	[54]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein S100-A10 (S100A10).	[55]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein S100-A10 (S100A10).	[43]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Protein S100-A10 (S100A10).	[43]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Protein S100-A10 (S100A10).	[56]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein S100-A10 (S100A10).	[51]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Protein S100-A10 (S100A10).	[57]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Protein S100-A10 (S100A10).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein S100-A10 (S100A10).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Protein S100-A10 (S100A10).	[60]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein S100-A10 (S100A10).	[61]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Protein S100-A10 (S100A10).	[62]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Protein S100-A10 (S100A10).	[63]

References

• [1] Mutations in the P10 region of procaspase-8 lead to chemotherapy resistance in acute myeloid leukemia by impairing procaspase-8 dimerization.Cell Death Dis. 2018 May 1;9(5):516. doi: 10.1038/s41419-018-0511-3.
• [2] CD62P and P10 as predictive markers for assessing the efficacy of hemodialysis in treating end-stage renal disease.J Clin Lab Anal. 2019 Feb;33(2):e22662. doi: 10.1002/jcla.22662. Epub 2018 Oct 15.
• [3] Discovery of Novel Nonsteroidal Anti-Inflammatory Drugs and Carbonic Anhydrase Inhibitors Hybrids (NSAIDs-CAIs) for the Management of Rheumatoid Arthritis.J Med Chem. 2018 Jun 14;61(11):4961-4977. doi: 10.1021/acs.jmedchem.8b00420. Epub 2018 May 21.
• [4] S100A10 upregulation associates with poor prognosis in lung squamous cell carcinoma.Biochem Biophys Res Commun. 2018 Oct 28;505(2):466-470. doi: 10.1016/j.bbrc.2018.09.118. Epub 2018 Sep 27.
• [5] In Silico prediction of the molecular basis of ClTx and AaCTx interaction with matrix metalloproteinase-2 (MMP-2) to inhibit glioma cell invasion.J Biomol Struct Dyn. 2017 Oct;35(13):2815-2829. doi: 10.1080/07391102.2016.1231633. Epub 2016 Sep 28.
• [6] iTRAQ-based proteomic analysis of DMH-induced colorectal cancer in mice reveals the expressions of -catenin, decorin, septin-7, and S100A10 expression in 53 cases of human hereditary polyposis colorectal cancer.Clin Transl Oncol. 2019 Feb;21(2):220-231. doi: 10.1007/s12094-018-1912-6. Epub 2018 Jun 28.
• [7] 5-HT1B and other related serotonergic proteins are altered in APPswe mutation. Neurosci Lett. 2015 May 6;594:137-43.
• [8] Silencing of the annexin II gene down-regulates the levels of S100A10, c-Myc, and plasmin and inhibits breast cancer cell proliferation and invasion.Saudi Med J. 2010 Apr;31(4):374-81.
• [9] Membranous overexpression of S100A10 is associated with a high-grade cellular status of breast carcinoma.Med Mol Morphol. 2020 Jun;53(2):104-114. doi: 10.1007/s00795-019-00236-3. Epub 2019 Nov 15.
• [10] S100A10 Is a Critical Mediator of GAS6/AXL-Induced Angiogenesis in Renal Cell Carcinoma.Cancer Res. 2019 Nov 15;79(22):5758-5768. doi: 10.1158/0008-5472.CAN-19-1366. Epub 2019 Oct 4.
• [11] IGF-II-Conjugated Nanocarrier for Brain-Targeted Delivery of p11 Gene for Depression.AAPS PharmSciTech. 2019 Jan 7;20(2):50. doi: 10.1208/s12249-018-1206-x.
• [12] S100A10 silencing suppresses proliferation, migration and invasion of ovarian cancer cells and enhances sensitivity to carboplatin.J Ovarian Res. 2019 Nov 18;12(1):113. doi: 10.1186/s13048-019-0592-3.
• [13] Primary central nervous system lymphoma and atypical glioblastoma: differentiation using the initial area under the curve derived from dynamic contrast-enhanced MR and the apparent diffusion coefficient.Eur Radiol. 2017 Apr;27(4):1344-1351. doi: 10.1007/s00330-016-4484-2. Epub 2016 Jul 19.
• [14] S100A expression and interleukin-10 polymorphisms are associated with ulcerative colitis and diarrhea predominant irritable bowel syndrome.Dig Dis Sci. 2013 Aug;58(8):2314-23. doi: 10.1007/s10620-013-2677-y. Epub 2013 Apr 18.
• [15] Comparative proteomic analysis between normal skin and keloid scar.Br J Dermatol. 2010 Jun;162(6):1302-15. doi: 10.1111/j.1365-2133.2010.09660.x. Epub 2010 Feb 1.
• [16] Epigenetic deregulation of multiple S100 gene family members by differential hypomethylation and hypermethylation events in medulloblastoma. Br J Cancer. 2007 Jul 16;97(2):267-74. doi: 10.1038/sj.bjc.6603852. Epub 2007 Jun 19.
• [17] Expression patterns of S100 proteins in melanocytes and melanocytic lesions.Melanoma Res. 2009 Aug;19(4):215-25. doi: 10.1097/CMR.0b013e32832c6358.
• [18] Dexmedetomidine inhibits the NF-B pathway and NLRP3 inflammasome to attenuate papain-induced osteoarthritis in rats.Pharm Biol. 2019 Dec;57(1):649-659. doi: 10.1080/13880209.2019.1651874.
• [19] Dendritic Cells Primed with Paracoccidioides brasiliensis Peptide P10 Are Therapeutic in Immunosuppressed Mice with Paracoccidioidomycosis.Front Microbiol. 2017 Jun 14;8:1057. doi: 10.3389/fmicb.2017.01057. eCollection 2017.
• [20] P11 (S100A10) as a potential biomarker of psychiatric patients at risk of suicide.J Psychiatr Res. 2011 Apr;45(4):435-41. doi: 10.1016/j.jpsychires.2010.08.012. Epub 2010 Sep 22.
• [21] Regulation of cell surface protease receptor S100A10 by retinoic acid therapy in acute promyelocytic leukemia (APL)(?.Cell Death Dis. 2018 Sep 11;9(9):920. doi: 10.1038/s41419-018-0954-6.
• [22] Prevalence of anti-S100A10 antibodies in antiphospholipid syndrome patients.Thromb Res. 2019 Jul;179:15-19. doi: 10.1016/j.thromres.2019.04.027. Epub 2019 Apr 24.
• [23] Expression and clinical role of chemoresponse-associated genes in ovarian serous carcinoma.Gynecol Oncol. 2015 Oct;139(1):30-9. doi: 10.1016/j.ygyno.2015.07.107. Epub 2015 Jul 29.
• [24] Reversal of depressed behaviors in mice by p11 gene therapy in the nucleus accumbens.Sci Transl Med. 2010 Oct 20;2(54):54ra76. doi: 10.1126/scitranslmed.3001079.
• [25] P11 Loss-of-Function is Associated with Decreased Cell Proliferation and Neurobehavioral Disorders in Mice.Int J Biol Sci. 2019 May 20;15(7):1383-1395. doi: 10.7150/ijbs.33773. eCollection 2019.
• [26] CPT1A-mediated succinylation of S100A10 increases human gastric cancer invasion.J Cell Mol Med. 2019 Jan;23(1):293-305. doi: 10.1111/jcmm.13920. Epub 2018 Nov 5.
• [27] Peptide P11 suppresses the growth of human thyroid carcinoma by inhibiting the PI3K/AKT/mTOR signaling pathway.Mol Biol Rep. 2019 Jun;46(3):2665-2678. doi: 10.1007/s11033-019-04698-7. Epub 2019 Apr 26.
• [28] S100A10, a novel biomarker in pancreatic ductal adenocarcinoma.Mol Oncol. 2018 Nov;12(11):1895-1916. doi: 10.1002/1878-0261.12356. Epub 2018 Sep 21.
• [29] Levels of the potential biomarker p11 in peripheral blood cells distinguish patients with PTSD from those with other major psychiatric disorders.J Psychiatr Res. 2009 Sep;43(13):1078-85. doi: 10.1016/j.jpsychires.2009.03.010. Epub 2009 Apr 19.
• [30] Carbonic anhydrase activation is associated with worsened pathological remodeling in human ischemic diabetic cardiomyopathy.J Am Heart Assoc. 2014 Mar 26;3(2):e000434. doi: 10.1161/JAHA.113.000434.
• [31] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [32] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [33] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [34] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [38] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Detection of gene expression alteration of myeloma cells treated with arsenic trioxide. Zhonghua Xue Ye Xue Za Zhi. 2005 Apr;26(4):209-13.
• [42] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [45] The human colon cancer methylome shows similar hypo- and hypermethylation at conserved tissue-specific CpG island shores. Nat Genet. 2009 Feb;41(2):178-186.
• [46] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [47] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [48] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [49] Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
• [50] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [51] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [52] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [53] Extracellular ATP drives breast cancer cell migration and metastasis via S100A4 production by cancer cells and fibroblasts. Cancer Lett. 2018 Aug 28;430:1-10. doi: 10.1016/j.canlet.2018.04.043. Epub 2018 May 5.
• [54] The -glucosidase inhibitor miglitol decreases glucose fluctuations and inflammatory cytokine gene expression in peripheral leukocytes of Japanese patients with type 2 diabetes mellitus. Metabolism. 2010 Dec;59(12):1816-22. doi: 10.1016/j.metabol.2010.06.006. Epub 2010 Jul 29.
• [55] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [56] MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
• [57] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [58] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [59] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [60] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [61] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [62] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [63] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [64] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [65] Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.