Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIZOJQV)

• DOT Name: Nuclear receptor-interacting protein 1 (NRIP1)
• Synonyms: Nuclear factor RIP140; Receptor-interacting protein 140
• Gene Name: NRIP1
• Related Disease:
  Adenocarcinoma
  Colon carcinoma
  Tubular aggregate myopathy
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Autism spectrum disorder
  Bone disease
  Breast cancer
  Carcinoma of esophagus
  Cardiac disease
  Cardiac failure
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colonic disorder
  Congenital anomaly of kidney and urinary tract
  Congestive heart failure
  Endometrial cancer
  Endometrial carcinoma
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Fatty liver disease
  Germ cell tumor
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Metabolic disorder
  Myocardial infarction
  Neoplasm of esophagus
  Neuroblastoma
  Osteoporosis
  Perianal crohn disease
  Postmenopausal osteoporosis
  Psoriasis
  Schizophrenia
  Small lymphocytic lymphoma
  Triple negative breast cancer
  Adenovirus infection
  Breast neoplasm
  Colorectal carcinoma
  Breast carcinoma
  Congenital anomalies of kidney and urinary tract 3
  Ductal breast carcinoma in situ
  Endometrium neoplasm
  Nasopharyngeal carcinoma
  Obesity
• UniProt ID: NRIP1_HUMAN
• PDB ID: 2GPO; 2GPP; 4S14; 4S15; 5NTI; 5NTN; 5NTW; 5NU1; 6FZU; 6G05; 6G07
• Pfam ID: PF15687 ; PF15688 ; PF15689 ; PF15690
• Sequence:
  MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPT
  CQSNGPVLNTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMV
  DSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHDSLKVEKDLRCYGV
  ASSHLKTLLKKSKVKDQKPDTNLPDVTKNLIRDRFAESPHHVGQSGTKVMSEPLSCAARL
  QAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAA
  MARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNA
  GYKNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDN
  NPSFTDDSSGDESSYSNCVPIDLSCKHRTEKSESDQPVSLDNFTQSLLNTWDPKVPDVDI
  KEDQDTSKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHNDVSKFNTQNYARTSVI
  ESPSTNRTTPVSTPPLLTSSKAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSM
  DLTKSKDPPGEKPAQNEGAQNSATFSASKLLQNLAQCGMQSSMSVEEQRPSKQLLTGNTD
  KPIGMIDRLNSPLLSNKTNAVEENKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGNP
  NKGKSEKKEKTPLRDESTQEHSERALSEQILMVKIKSEPCDDLQIPNTNVHLSHDAKSAP
  FLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHR
  NNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEEL
  KFSRNDLEFKYPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADS
  KKKGHKNNVTNSKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGC
  AGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPILYYMLQKGGNSVT
  SRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSAN
  GEVYGLLGSVLTIKKESE
• Function: Modulates transcriptional activation by steroid receptors such as NR3C1, NR3C2 and ESR1. Also modulates transcriptional repression by nuclear hormone receptors. Positive regulator of the circadian clock gene expression: stimulates transcription of BMAL1, CLOCK and CRY1 by acting as a coactivator for RORA and RORC. Involved in the regulation of ovarian function. Plays a role in renal development.
• Reactome Pathway:
  Circadian Clock (R-HSA-400253)
  Estrogen-dependent gene expression (R-HSA-9018519)
  NR1H2 & NR1H3 regulate gene expression linked to lipogenesis (R-HSA-9029558)
  NR1H2 & NR1H3 regulate gene expression linked to gluconeogenesis (R-HSA-9632974)
  Heme signaling (R-HSA-9707616)
  SUMOylation of transcription cofactors (R-HSA-3899300)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Altered Expression	[1]
Colon carcinoma	DISJYKUO	Definitive	Biomarker	[1]
Tubular aggregate myopathy	DISC11WH	Definitive	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[6]
Bone disease	DISE1F82	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[9]
Cardiac disease	DISVO1I5	Strong	Altered Expression	[10]
Cardiac failure	DISDC067	Strong	Biomarker	[11]
Cervical cancer	DISFSHPF	Strong	Biomarker	[12]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[12]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colonic disorder	DISXXS3L	Strong	Genetic Variation	[13]
Congenital anomaly of kidney and urinary tract	DIS84IVH	Strong	CausalMutation	[14]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[11]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[15]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[16]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[17]
Germ cell tumor	DIS62070	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[19]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[13]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[20]
Myocardial infarction	DIS655KI	Strong	Biomarker	[11]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[9]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[4]
Osteoporosis	DISF2JE0	Strong	Genetic Variation	[21]
Perianal crohn disease	DISOV578	Strong	Biomarker	[13]
Postmenopausal osteoporosis	DISS0RQZ	Strong	Biomarker	[21]
Psoriasis	DIS59VMN	Strong	Biomarker	[22]
Schizophrenia	DISSRV2N	Strong	Biomarker	[23]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[24]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[25]
Adenovirus infection	DISUYSBZ	moderate	Altered Expression	[10]
Breast neoplasm	DISNGJLM	moderate	Biomarker	[26]
Colorectal carcinoma	DIS5PYL0	moderate	Genetic Variation	[27]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[25]
Congenital anomalies of kidney and urinary tract 3	DISC44XU	Limited	Autosomal dominant	[28]
Ductal breast carcinoma in situ	DISLCJY7	Limited	Altered Expression	[29]
Endometrium neoplasm	DIS6OS2L	Limited	Biomarker	[16]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[30]
Obesity	DIS47Y1K	Limited	Genetic Variation	[31]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitomycin	DMH0ZJE	Approved	Nuclear receptor-interacting protein 1 (NRIP1) affects the response to substance of Mitomycin.	[61]
Mitoxantrone	DMM39BF	Approved	Nuclear receptor-interacting protein 1 (NRIP1) affects the response to substance of Mitoxantrone.	[61]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Nuclear receptor-interacting protein 1 (NRIP1).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nuclear receptor-interacting protein 1 (NRIP1).	[51]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Nuclear receptor-interacting protein 1 (NRIP1).	[53]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Nuclear receptor-interacting protein 1 (NRIP1).	[54]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[34]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[35]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[37]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[38]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[39]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[40]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[41]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[42]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[43]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[44]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[45]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[46]
Teniposide	DMLW57T	Approved	Teniposide decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[43]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[47]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[48]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[49]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[35]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[52]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[41]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[55]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[56]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[57]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[58]
Daidzein	DMRFTJX	Investigative	Daidzein increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[35]
T0901317	DMZQVDI	Investigative	T0901317 increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[59]
9-phenanthrol	DMJFBQ1	Investigative	9-phenanthrol increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[60]
paxilline	DMPF2N1	Investigative	paxilline increases the expression of Nuclear receptor-interacting protein 1 (NRIP1).	[59]

References

• [1] RIP140 increases APC expression and controls intestinal homeostasis and tumorigenesis.J Clin Invest. 2014 May;124(5):1899-913. doi: 10.1172/JCI65178. Epub 2014 Mar 25.
• [2] Overexpression of RIP140 suppresses the malignant potential of hepatocellular carcinoma by inhibiting NFBmediated alternative polarization of macrophages.Oncol Rep. 2017 May;37(5):2971-2979. doi: 10.3892/or.2017.5551. Epub 2017 Apr 5.
• [3] Importance of RIP140 and LCoR Sub-Cellular Localization for Their Association With Breast Cancer Aggressiveness and Patient Survival.Transl Oncol. 2018 Oct;11(5):1090-1096. doi: 10.1016/j.tranon.2018.06.006. Epub 2018 Jul 11.
• [4] The nuclear cofactor receptor interacting protein-140 (RIP140) regulates the expression of genes involved in A generation.Neurobiol Aging. 2016 Nov;47:180-191. doi: 10.1016/j.neurobiolaging.2016.08.003. Epub 2016 Aug 12.
• [5] Transcriptional co-regulator RIP140: An important mediator of the inflammatory response and its associated diseases (Review).Mol Med Rep. 2017 Aug;16(2):994-1000. doi: 10.3892/mmr.2017.6683. Epub 2017 Jun 2.
• [6] Expression and Regulatory Network Analysis of miR-140-3p, a New Potential Serum Biomarker for Autism Spectrum Disorder.Front Mol Neurosci. 2017 Aug 10;10:250. doi: 10.3389/fnmol.2017.00250. eCollection 2017.
• [7] RIP140 in monocytes/macrophages regulates osteoclast differentiation and bone homeostasis.JCI Insight. 2017 Apr 6;2(7):e90517. doi: 10.1172/jci.insight.90517.
• [8] Prognostic relevance of RIP140 and ER expression in unifocal versus multifocal breast cancers: a preliminary report.Int J Mol Sci. 2019 Jan 18;20(2):418. doi: 10.3390/ijms20020418.
• [9] MicroRNA-548-3p and MicroRNA-576-5p enhance the migration and invasion of esophageal squamous cell carcinoma cells via NRIP1 down-regulation.Neoplasma. 2018 Nov 15;65(6):881-887. doi: 10.4149/neo_2018_171206N803. Epub 2018 Jun 17.
• [10] Receptor-interacting Protein 140 represses Sirtuin 3 to facilitate hypertrophy, mitochondrial dysfunction and energy metabolic dysfunction in cardiomyocytes.Acta Physiol (Oxf). 2017 May;220(1):58-71. doi: 10.1111/apha.12800. Epub 2016 Oct 12.
• [11] Receptor-interacting protein 140 overexpression impairs cardiac mitochondrial function and accelerates the transition to heart failure in chronically infarcted rats.Transl Res. 2017 Feb;180:91-102.e1. doi: 10.1016/j.trsl.2016.08.005. Epub 2016 Aug 31.
• [12] Investigation of RIP140 and LCoR as independent markers for poor prognosis in cervical cancer.Oncotarget. 2017 Oct 31;8(62):105356-105371. doi: 10.18632/oncotarget.22187. eCollection 2017 Dec 1.
• [13] Perianal Crohn's Disease is Associated with Distal Colonic Disease, Stricturing Disease Behavior, IBD-Associated Serologies and Genetic Variation in the JAK-STAT Pathway.Inflamm Bowel Dis. 2016 Apr;22(4):862-9. doi: 10.1097/MIB.0000000000000705.
• [14] A Dominant Mutation in Nuclear Receptor Interacting Protein 1 Causes Urinary Tract Malformations via Dysregulation of Retinoic Acid Signaling.J Am Soc Nephrol. 2017 Aug;28(8):2364-2376. doi: 10.1681/ASN.2016060694. Epub 2017 Apr 5.
• [15] New target genes in endometrial tumors show a role for the estrogen-receptor pathway in microsatellite-unstable cancers.Hum Mutat. 2014 Dec;35(12):1514-23. doi: 10.1002/humu.22700.
• [16] The genomic landscape and evolution of endometrial carcinoma progression and abdominopelvic metastasis.Nat Genet. 2016 Aug;48(8):848-55. doi: 10.1038/ng.3602. Epub 2016 Jun 27.
• [17] Nuclear receptor cofactor receptor interacting protein 140 controls hepatic triglyceride metabolism during wasting in mice.Hepatology. 2008 Sep;48(3):782-91. doi: 10.1002/hep.22383.
• [18] Selective repression of retinoic acid target genes by RIP140 during induced tumor cell differentiation of pluripotent human embryonal carcinoma cells.Mol Cancer. 2007 Sep 19;6:57. doi: 10.1186/1476-4598-6-57.
• [19] Synergistic effect of receptor-interacting protein 140 and simvastatin on the inhibition of proliferation and survival of hepatocellular carcinoma cells.Oncol Lett. 2018 Apr;15(4):4344-4350. doi: 10.3892/ol.2018.7831. Epub 2018 Jan 19.
• [20] Involvement of receptor-interacting protein 140 in estrogen-mediated osteoclasts differentiation, apoptosis, and bone resorption.J Physiol Sci. 2017 Jan;67(1):141-150. doi: 10.1007/s12576-016-0447-2. Epub 2016 Mar 26.
• [21] Multilocus analysis of estrogen-related genes in Spanish postmenopausal women suggests an interactive role of ESR1, ESR2 and NRIP1 genes in the pathogenesis of osteoporosis.Bone. 2006 Jul;39(1):213-21. doi: 10.1016/j.bone.2005.12.079. Epub 2006 Mar 10.
• [22] Overexpression and potential roles of NRIP1 in psoriasis.Oncotarget. 2016 Nov 8;7(45):74236-74246. doi: 10.18632/oncotarget.12371.
• [23] Increased exonic de novo mutation rate in individuals with schizophrenia. Nat Genet. 2011 Jul 10;43(9):860-3. doi: 10.1038/ng.886.
• [24] Expression and role of RIP140/NRIP1 in chronic lymphocytic leukemia.J Hematol Oncol. 2015 Mar 4;8:20. doi: 10.1186/s13045-015-0116-6.
• [25] Downregulation of RIP140 in triple-negative breast cancer inhibits the growth and proliferation of cancer cells.Oncol Lett. 2018 Jun;15(6):8784-8788. doi: 10.3892/ol.2018.8434. Epub 2018 Apr 5.
• [26] Genome-wide association analysis identifies three new breast cancer susceptibility loci.Nat Genet. 2012 Jan 22;44(3):312-8. doi: 10.1038/ng.1049.
• [27] Intratumoral Heterogeneity of Somatic Mutations for NRIP1, DOK1, ULK1, ULK2, DLGAP3, PARD3 and PRKCI in Colon Cancers.Pathol Oncol Res. 2018 Oct;24(4):827-832. doi: 10.1007/s12253-017-0297-0. Epub 2017 Aug 26.
• [28] A genome sequencing program for novel undiagnosed diseases. Genet Med. 2015 Dec;17(12):995-1001. doi: 10.1038/gim.2015.21. Epub 2015 Mar 19.
• [29] Expression of microRNA and their gene targets are dysregulated in preinvasive breast cancer.Breast Cancer Res. 2011 Mar 4;13(2):R24. doi: 10.1186/bcr2839.
• [30] Elevated SUV39H2 attributes to the progression of nasopharyngeal carcinoma via regulation of NRIP1.Biochem Biophys Res Commun. 2019 Mar 5;510(2):290-295. doi: 10.1016/j.bbrc.2019.01.092. Epub 2019 Jan 30.
• [31] FLT1 and transcriptome-wide polyadenylation site (PAS) analysis in preeclampsia.Sci Rep. 2017 Sep 22;7(1):12139. doi: 10.1038/s41598-017-11639-6.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [34] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [35] Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
• [36] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [37] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [38] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [39] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [40] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [41] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [42] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [43] Regulation of Hepatic Cholesteryl Ester Transfer Protein Expression and Reverse Cholesterol Transport by Inhibition of DNA Topoisomerase II. J Biol Chem. 2015 Jun 5;290(23):14418-29. doi: 10.1074/jbc.M115.643015. Epub 2015 Apr 25.
• [44] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [45] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [46] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [47] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [48] Curcumin inhibits esophageal squamous cell carcinoma progression through down-regulating the circNRIP1/miR-532-3p/AKT pathway. Environ Toxicol. 2023 Nov;38(11):2705-2716. doi: 10.1002/tox.23905. Epub 2023 Jul 20.
• [49] The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
• [50] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [53] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [54] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [55] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [56] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [57] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [58] Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
• [59] Combinations of LXR and RXR agonists induce triglyceride accumulation in human HepaRG cells in a synergistic manner. Arch Toxicol. 2020 Apr;94(4):1303-1320. doi: 10.1007/s00204-020-02685-7. Epub 2020 Mar 2.
• [60] Differential action of monohydroxylated polycyclic aromatic hydrocarbons with estrogen receptors and . Toxicol Sci. 2013 Apr;132(2):359-67. doi: 10.1093/toxsci/kfs287. Epub 2012 Sep 18.
• [61] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.