Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKLU61J)

• DOT Name: Estrogen receptor (ESR1)
• Synonyms: ER; ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1
• Gene Name: ESR1
• Related Disease: Estrogen resistance syndrome
• UniProt ID: ESR1_HUMAN
• PDB ID: 1A52 ; 1ERE ; 1ERR ; 1G50 ; 1GWQ ; 1GWR ; 1HCP ; 1HCQ ; 1L2I ; 1PCG ; 1QKT ; 1QKU ; 1R5K ; 1SJ0 ; 1UOM ; 1X7E ; 1X7R ; 1XP1 ; 1XP6 ; 1XP9 ; 1XPC ; 1XQC ; 1YIM ; 1YIN ; 1ZKY ; 2AYR ; 2B1V ; 2B1Z ; 2B23 ; 2BJ4 ; 2FAI ; 2G44 ; 2G5O ; 2I0J ; 2IOG ; 2IOK ; 2JF9 ; 2JFA ; 2LLO ; 2LLQ ; 2OCF ; 2OUZ ; 2P15 ; 2POG ; 2Q6J ; 2Q70 ; 2QA6 ; 2QA8 ; 2QAB ; 2QE4 ; 2QGT ; 2QGW ; 2QH6 ; 2QR9 ; 2QSE ; 2QXM ; 2QXS ; 2QZO ; 2R6W ; 2R6Y ; 2YAT ; 2YJA ; 3CBM ; 3CBO ; 3CBP ; 3DT3 ; 3ERD ; 3ERT ; 3HLV ; 3HM1 ; 3L03 ; 3OS8 ; 3OS9 ; 3OSA ; 3Q95 ; 3UU7 ; 3UUA ; 3UUC ; 3UUD ; 4AA6 ; 4DMA ; 4IU7 ; 4IUI ; 4IV2 ; 4IV4 ; 4IVW ; 4IVY ; 4IW6 ; 4IW8 ; 4IWC ; 4IWF ; 4JC3 ; 4JDD ; 4MG5 ; 4MG6 ; 4MG7 ; 4MG8 ; 4MG9 ; 4MGA ; 4MGB ; 4MGC ; 4MGD ; 4O6F ; 4PP6 ; 4PPP ; 4PPS ; 4PXM ; 4Q13 ; 4Q50 ; 4TUZ ; 4TV1 ; 4XI3 ; 4ZN7 ; 4ZN9 ; 4ZNH ; 4ZNS ; 4ZNT ; 4ZNU ; 4ZNV ; 4ZNW ; 5AAU ; 5AAV ; 5ACC ; 5AK2 ; 5DI7 ; 5DID ; 5DIE ; 5DIG ; 5DK9 ; 5DKB ; 5DKE ; 5DKG ; 5DKS ; 5DL4 ; 5DLR ; 5DMC ; 5DMF ; 5DP0 ; 5DRJ ; 5DRM ; 5DTV ; 5DU5 ; 5DUE ; 5DUG ; 5DUH ; 5DVS ; 5DVV ; 5DWE ; 5DWG ; 5DWI ; 5DWJ ; 5DX3 ; 5DXB ; 5DXE ; 5DXG ; 5DXK ; 5DXM ; 5DXP ; 5DXQ ; 5DXR ; 5DY8 ; 5DYB ; 5DYD ; 5DZ0 ; 5DZ1 ; 5DZ3 ; 5DZH ; 5DZI ; 5E0W ; 5E0X ; 5E14 ; 5E15 ; 5E19 ; 5E1C ; 5EGV ; 5EHJ ; 5EI1 ; 5EIT ; 5FQP ; 5FQR ; 5FQS ; 5FQT ; 5FQV ; 5GS4 ; 5GTR ; 5HYR ; 5JMM ; 5KCC ; 5KCD ; 5KCE ; 5KCF ; 5KCT ; 5KCU ; 5KCW ; 5KD9 ; 5KR9 ; 5KRA ; 5KRC ; 5KRF ; 5KRH ; 5KRI ; 5KRJ ; 5KRK ; 5KRL ; 5KRM ; 5KRO ; 5N10 ; 5T0X ; 5T1Z ; 5T92 ; 5T97 ; 5TLD ; 5TLF ; 5TLG ; 5TLL ; 5TLM ; 5TLO ; 5TLP ; 5TLT ; 5TLU ; 5TLV ; 5TLX ; 5TLY ; 5TM1 ; 5TM2 ; 5TM3 ; 5TM4 ; 5TM5 ; 5TM6 ; 5TM7 ; 5TM8 ; 5TM9 ; 5TML ; 5TMM ; 5TMO ; 5TMQ ; 5TMR ; 5TMS ; 5TMT ; 5TMU ; 5TMV ; 5TMW ; 5TMZ ; 5TN1 ; 5TN3 ; 5TN4 ; 5TN5 ; 5TN6 ; 5TN7 ; 5TN8 ; 5TN9 ; 5TNB ; 5U2B ; 5U2D ; 5UFW ; 5UFX ; 5W9C ; 5W9D ; 5WGD ; 5WGQ ; 6B0F ; 6C42 ; 6CBZ ; 6CHW ; 6CHZ ; 6CZN ; 6D0F ; 6DF6 ; 6DFN ; 6HHP ; 6HKB ; 6HKF ; 6HMU ; 6IAR ; 6OWC ; 6PET ; 6PFM ; 6PIT ; 6PSJ ; 6SBO ; 6SQ0 ; 6SUO ; 6TJM ; 6TL3 ; 6V87 ; 6V8T ; 6VGH ; 6VJD ; 6VPF ; 6WOK ; 6ZOQ ; 6ZOR ; 6ZOS ; 7B9M ; 7B9R ; 7B9T ; 7BA3 ; 7BA5 ; 7BA6 ; 7BA7 ; 7BA8 ; 7BA9 ; 7BAA ; 7BAB ; 7JHD ; 7KBS ; 7MSA ; 7N9O ; 7NDO ; 7NEL ; 7NFB ; 7NFW ; 7NIZ ; 7OPW ; 7OQ7 ; 7OQ8 ; 7PWT ; 7PWZ ; 7QVJ ; 7QVL ; 7R62 ; 7RKE ; 7RNM ; 7RRX ; 7RRY ; 7RRZ ; 7RS0 ; 7RS1 ; 7RS2 ; 7RS3 ; 7RS4 ; 7RS7 ; 7RS8 ; 7RS9 ; 7SFO ; 7T2X ; 7TE7 ; 7UJ7 ; 7UJ8 ; 7UJC ; 7UJF ; 7UJM ; 7UJO ; 7UJW ; 7UJY ; 7WNV ; 7Y8F ; 7Y8G ; 7YMK ; 8AFN ; 8AI0 ; 8ALR ; 8ALT ; 8ALV ; 8ALW ; 8AM7 ; 8ANF ; 8AOY ; 8APS ; 8AQ1 ; 8AQC ; 8AQE ; 8AQZ ; 8AR4 ; 8AR5 ; 8ARG ; 8ARO ; 8ARQ ; 8ARR ; 8ARW ; 8ARX ; 8ARY ; 8ARZ ; 8AS1 ; 8AT9 ; 8ATP ; 8AU2 ; 8AUS ; 8AUY ; 8AV3 ; 8AV4 ; 8AV7 ; 8AV8 ; 8AWG ; 8AXE ; 8AXU ; 8B39 ; 8BWJ ; 8BWX ; 8BWZ ; 8BX0 ; 8BX3 ; 8BX4 ; 8BXI ; 8BXM ; 8BXN ; 8BXO ; 8BXQ ; 8BXS ; 8BY9 ; 8BYB ; 8BYC ; 8BYD ; 8BYE ; 8BYF ; 8BYO ; 8BYY ; 8BYZ ; 8BZ0 ; 8BZA ; 8BZB ; 8BZW ; 8C04 ; 8C0K ; 8C4F ; 8C4G ; 8DU6 ; 8DU8 ; 8DU9 ; 8DUB ; 8DUC ; 8DUD ; 8DUG ; 8DUH ; 8DUI ; 8DUK ; 8DUS ; 8DV5 ; 8DV7 ; 8DV8 ; 8DVB ; 8EV1 ; 8EV2
• Pfam ID: PF12743 ; PF00104 ; PF02159 ; PF00105
• Sequence:
  MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
  EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
  LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
  ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
  RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
  SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
  AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
  MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
  KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
  LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
• Function: Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Maintains neuronal survival in response to ischemic reperfusion injury when in the presence of circulating estradiol (17-beta-estradiol/E2); [Isoform 3]: Involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor. Binds to ERE and inhibits isoform 1.
• Tissue Specificity: Widely expressed . Not expressed in the pituitary gland .; [Isoform 3]: Widely expressed, however not expressed in the pituitary gland.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  Estrogen sig.ling pathway (hsa04915)
  Prolactin sig.ling pathway (hsa04917)
  Thyroid hormone sig.ling pathway (hsa04919)
  Endocrine and other factor-regulated calcium reabsorption (hsa04961)
  Pathways in cancer (hsa05200)
  Proteoglycans in cancer (hsa05205)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Breast cancer (hsa05224)
• Reactome Pathway:
  PIP3 activates AKT signaling (R-HSA-1257604)
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  Nuclear Receptor transcription pathway (R-HSA-383280)
  SUMOylation of intracellular receptors (R-HSA-4090294)
  Ovarian tumor domain proteases (R-HSA-5689896)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  TFAP2 (AP-2) family regulates transcription of growth factors and their receptors (R-HSA-8866910)
  RUNX1 regulates estrogen receptor mediated transcription (R-HSA-8931987)
  ESR-mediated signaling (R-HSA-8939211)
  RUNX1 regulates transcription of genes involved in WNT signaling (R-HSA-8939256)
  Regulation of RUNX2 expression and activity (R-HSA-8939902)
  Extra-nuclear estrogen signaling (R-HSA-9009391)
  Estrogen-dependent gene expression (R-HSA-9018519)
  Nuclear signaling by ERBB4 (R-HSA-1251985)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Estrogen resistance syndrome	DIS2SYXC	Supportive	Autosomal recessive	[1]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Estrogen receptor (ESR1) increases the response to substance of Cisplatin.	[80]
Methamphetamine	DMPM4SK	Approved	Estrogen receptor (ESR1) increases the response to substance of Methamphetamine.	[81]
Medroxyprogesterone	DMBGWPH	Approved	Estrogen receptor (ESR1) increases the Breast cancer ADR of Medroxyprogesterone.	[82]
Conjugated estrogens	DMLT0E1	Approved	Estrogen receptor (ESR1) increases the Bone density increased ADR of Conjugated estrogens.	[82]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Estrogen receptor (ESR1).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the methylation of Estrogen receptor (ESR1).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the methylation of Estrogen receptor (ESR1).	[10]
Gefitinib	DM15F0X	Approved	Gefitinib decreases the phosphorylation of Estrogen receptor (ESR1).	[35]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the phosphorylation of Estrogen receptor (ESR1).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Estrogen receptor (ESR1).	[69]

86 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Estrogen receptor (ESR1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Estrogen receptor (ESR1).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Estrogen receptor (ESR1).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Estrogen receptor (ESR1).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Estrogen receptor (ESR1).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Estrogen receptor (ESR1).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Estrogen receptor (ESR1).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Estrogen receptor (ESR1).	[12]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Estrogen receptor (ESR1).	[13]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Estrogen receptor (ESR1).	[14]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Estrogen receptor (ESR1).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine decreases the expression of Estrogen receptor (ESR1).	[16]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Estrogen receptor (ESR1).	[17]
Marinol	DM70IK5	Approved	Marinol increases the expression of Estrogen receptor (ESR1).	[18]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Estrogen receptor (ESR1).	[19]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Estrogen receptor (ESR1).	[21]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Estrogen receptor (ESR1).	[22]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Estrogen receptor (ESR1).	[23]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Estrogen receptor (ESR1).	[24]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Estrogen receptor (ESR1).	[25]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Estrogen receptor (ESR1).	[26]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the activity of Estrogen receptor (ESR1).	[27]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Estrogen receptor (ESR1).	[28]
Malathion	DMXZ84M	Approved	Malathion decreases the activity of Estrogen receptor (ESR1).	[29]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Estrogen receptor (ESR1).	[30]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Estrogen receptor (ESR1).	[31]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Estrogen receptor (ESR1).	[32]
Daunorubicin	DMQUSBT	Approved	Daunorubicin decreases the activity of Estrogen receptor (ESR1).	[33]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Estrogen receptor (ESR1).	[34]
Lindane	DMB8CNL	Approved	Lindane decreases the expression of Estrogen receptor (ESR1).	[21]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Estrogen receptor (ESR1).	[36]
Estrone	DM5T6US	Approved	Estrone increases the expression of Estrogen receptor (ESR1).	[31]
Melatonin	DMKWFBT	Approved	Melatonin decreases the expression of Estrogen receptor (ESR1).	[38]
Adenosine	DMM2NSK	Approved	Adenosine increases the expression of Estrogen receptor (ESR1).	[39]
Mestranol	DMG3F94	Approved	Mestranol increases the activity of Estrogen receptor (ESR1).	[40]
Estriol	DMOEM2I	Approved	Estriol increases the expression of Estrogen receptor (ESR1).	[41]
Mitotane	DMU1GX0	Approved	Mitotane increases the activity of Estrogen receptor (ESR1).	[42]
Nifedipine	DMSVOZT	Approved	Nifedipine increases the activity of Estrogen receptor (ESR1).	[33]
Lapatinib	DM3BH1Y	Approved	Lapatinib decreases the activity of Estrogen receptor (ESR1).	[43]
Prasterone	DM67VKL	Approved	Prasterone increases the expression of Estrogen receptor (ESR1).	[44]
Flutamide	DMK0O7U	Approved	Flutamide increases the expression of Estrogen receptor (ESR1).	[45]
Lidocaine	DML4ZOT	Approved	Lidocaine increases the expression of Estrogen receptor (ESR1).	[11]
Tibolone	DM78XFG	Approved	Tibolone increases the activity of Estrogen receptor (ESR1).	[46]
Chloramphenicol	DMFXEWT	Approved	Chloramphenicol increases the expression of Estrogen receptor (ESR1).	[11]
Felodipine	DMOSW35	Approved	Felodipine increases the activity of Estrogen receptor (ESR1).	[33]
Hydralazine	DMU8JGH	Approved	Hydralazine increases the expression of Estrogen receptor (ESR1).	[47]
Procaine	DM4LSNE	Approved	Procaine increases the expression of Estrogen receptor (ESR1).	[11]
Idarubicin	DMM0XGL	Approved	Idarubicin decreases the activity of Estrogen receptor (ESR1).	[33]
ARZOXIFENE	DMOKCVI	Approved	ARZOXIFENE decreases the activity of Estrogen receptor (ESR1).	[48]
Nisoldipine	DM7ISKJ	Approved	Nisoldipine decreases the activity of Estrogen receptor (ESR1).	[33]
Goserelin	DMAT8CG	Approved	Goserelin decreases the expression of Estrogen receptor (ESR1).	[49]
Dienestrol	DMBSXI0	Approved	Dienestrol decreases the activity of Estrogen receptor (ESR1).	[50]
Methyltestosterone	DMWLFGO	Approved	Methyltestosterone increases the expression of Estrogen receptor (ESR1).	[51]
Proflavine	DMF1X5P	Approved	Proflavine increases the activity of Estrogen receptor (ESR1).	[52]
Liraglutide	DM3FXPS	Approved	Liraglutide increases the expression of Estrogen receptor (ESR1).	[53]
Ospemifene	DMC4GEI	Approved	Ospemifene decreases the expression of Estrogen receptor (ESR1).	[54]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Estrogen receptor (ESR1).	[44]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the activity of Estrogen receptor (ESR1).	[55]
Benidipine	DMWNP6B	Phase 4	Benidipine decreases the activity of Estrogen receptor (ESR1).	[33]
Lacidipine	DMQP5I3	Phase 4	Lacidipine increases the activity of Estrogen receptor (ESR1).	[33]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Estrogen receptor (ESR1).	[56]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the activity of Estrogen receptor (ESR1).	[33]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Estrogen receptor (ESR1).	[57]
I3C	DMIGFOR	Phase 3	I3C decreases the expression of Estrogen receptor (ESR1).	[58]
EXISULIND	DMBY56U	Phase 3	EXISULIND decreases the expression of Estrogen receptor (ESR1).	[59]
Manidipine	DMJPGUA	Phase 3	Manidipine decreases the activity of Estrogen receptor (ESR1).	[33]
Cilnidipine	DM1975O	Phase 3	Cilnidipine decreases the activity of Estrogen receptor (ESR1).	[33]
ABC294640	DMCKPG4	Phase 3	ABC294640 decreases the activity of Estrogen receptor (ESR1).	[61]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Estrogen receptor (ESR1).	[9]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Estrogen receptor (ESR1).	[11]
DNCB	DMDTVYC	Phase 2	DNCB affects the expression of Estrogen receptor (ESR1).	[62]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the activity of Estrogen receptor (ESR1).	[63]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Estrogen receptor (ESR1).	[64]
(Z)-endoxifen	DMGDOS2	Phase 2	(Z)-endoxifen decreases the expression of Estrogen receptor (ESR1).	[66]
Icaritin	DMGHQ37	Phase 2	Icaritin increases the activity of Estrogen receptor (ESR1).	[67]
ERB-041	DMCEPUA	Phase 2	ERB-041 increases the activity of Estrogen receptor (ESR1).	[42]
G1	DMTV42K	Phase 1/2	G1 increases the expression of Estrogen receptor (ESR1).	[44]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Estrogen receptor (ESR1).	[70]
GSK525762	DMPAWBN	Phase 1	GSK525762 decreases the expression of Estrogen receptor (ESR1).	[71]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Estrogen receptor (ESR1).	[72]
Phenolphthalein	DM5SICT	Withdrawn from market	Phenolphthalein increases the activity of Estrogen receptor (ESR1).	[50]
FORMESTANE	DMWIDJK	Withdrawn from market	FORMESTANE increases the expression of Estrogen receptor (ESR1).	[76]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin decreases the expression of Estrogen receptor (ESR1).	[77]
MX-4509	DMC4RK7	Discontinued in Phase 1	MX-4509 increases the expression of Estrogen receptor (ESR1).	[51]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Estrogen receptor (ESR1).	[78]
Dioscin	DM5H2W9	Preclinical	Dioscin increases the expression of Estrogen receptor (ESR1).	[79]

8 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Menadione	DMSJDTY	Approved	Menadione affects the binding of Estrogen receptor (ESR1).	[20]
Hexachlorophene	DMLKSE0	Approved	Hexachlorophene affects the binding of Estrogen receptor (ESR1).	[20]
Guaiacol	DMN4E7T	Phase 3	Guaiacol affects the binding of Estrogen receptor (ESR1).	[60]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN affects the binding of Estrogen receptor (ESR1).	[65]
Pyrethroids	DM1794O	Phase 2	Pyrethroids affects the binding of Estrogen receptor (ESR1).	[68]
Eugenol	DM7US1H	Patented	Eugenol affects the binding of Estrogen receptor (ESR1).	[73]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 affects the binding of Estrogen receptor (ESR1).	[74]
HEXESTROL	DM9AGWQ	Withdrawn from market	HEXESTROL affects the binding of Estrogen receptor (ESR1).	[75]

References

• [1] Estrogen resistance caused by a mutation in the estrogen-receptor gene in a man. N Engl J Med. 1994 Oct 20;331(16):1056-61. doi: 10.1056/NEJM199410203311604.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Novel retinoic acid metabolism blocking agents have potent inhibitory activities on human breast cancer cells and tumour growth. Br J Cancer. 2007 Apr 23;96(8):1204-15. doi: 10.1038/sj.bjc.6603705. Epub 2007 Mar 27.
• [5] Transcriptional regulation of estrogen receptor-alpha by p53 in human breast cancer cells. Cancer Res. 2009 Apr 15;69(8):3405-14. doi: 10.1158/0008-5472.CAN-08-3628. Epub 2009 Apr 7.
• [6] Estrogen-like activity of metals in MCF-7 breast cancer cells. Endocrinology. 2003 Jun;144(6):2425-36. doi: 10.1210/en.2002-221054.
• [7] Selective Inhibition of SIN3 Corepressor with Avermectins as a Novel Therapeutic Strategy in Triple-Negative Breast Cancer. Mol Cancer Ther. 2015 Aug;14(8):1824-36. doi: 10.1158/1535-7163.MCT-14-0980-T. Epub 2015 Jun 15.
• [8] Inorganic arsenic promotes luminal to basal transition and metastasis of breast cancer. FASEB J. 2020 Dec;34(12):16034-16048. doi: 10.1096/fj.202001192R. Epub 2020 Oct 13.
• [9] Estrogen receptor alpha mediates the proliferative but not the cytotoxic dose-dependent effects of two major phytoestrogens on human breast cancer cells. Mol Pharmacol. 2001 Sep;60(3):595-602.
• [10] [Arsenic trioxide restores ER expression in ER-negative human breast cancer cells and its treatment efficacy in combination with tamoxifen in xenografts in nude mice]. Zhonghua Zhong Liu Za Zhi. 2012 Sep;34(9):645-51. doi: 10.3760/cma.j.issn.0253-3766.2012.09.002.
• [11] Sensitivity of human dental pulp cells to eighteen chemical agents used for endodontic treatments in dentistry. Odontology. 2013 Jan;101(1):43-51.
• [12] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [13] Histone deacetylase inhibitor SAHA induces ERalpha degradation in breast cancer MCF-7 cells by CHIP-mediated ubiquitin pathway and inhibits survival signaling. Biochem Pharmacol. 2008 May 1;75(9):1697-705. doi: 10.1016/j.bcp.2007.10.035. Epub 2007 Nov 9.
• [14] Expression of estrogen-, progesterone-, and androgen-responsive genes in MCF-7 and MDA-MB-231 cells treated with o,p'-DDT, p,p'-DDT, or endosulfan. J Biochem Mol Toxicol. 2021 Jun;35(6):1-8. doi: 10.1002/jbt.22773. Epub 2021 Mar 16.
• [15] The in vitro estrogenic activities of triclosan and triclocarban. J Appl Toxicol. 2014 Sep;34(9):1060-7. doi: 10.1002/jat.3012. Epub 2014 Apr 16.
• [16] [Inhibitory effect of carbamazepine on proliferation of estrogen-dependent breast cancer cells]. Ai Zheng. 2006 Aug;25(8):967-73.
• [17] Trichostatin A and 5 Aza-2' deoxycytidine decrease estrogen receptor mRNA stability in ER positive MCF7 cells through modulation of HuR. Breast Cancer Res Treat. 2008 Sep;111(1):15-25. doi: 10.1007/s10549-007-9751-0. Epub 2007 Sep 21.
• [18] The Cannabinoid Delta-9-tetrahydrocannabinol Disrupts Estrogen Signaling in Human Placenta. Toxicol Sci. 2020 Oct 1;177(2):420-430. doi: 10.1093/toxsci/kfaa110.
• [19] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [20] Anti-estrogenic activity of fifty chemicals evaluated by in vitro assays. Life Sci. 2004 May 7;74(25):3065-74. doi: 10.1016/j.lfs.2003.10.030.
• [21] Cross-talk between non-genomic and genomic signalling pathways--distinct effect profiles of environmental estrogens. Toxicol Appl Pharmacol. 2010 Jun 1;245(2):160-70. doi: 10.1016/j.taap.2010.02.015. Epub 2010 Mar 4.
• [22] The modulation of aromatase and estrogen receptor alpha in cultured human dermal papilla cells by dexamethasone: a novel mechanism for selective action of estrogen via estrogen receptor beta? J Invest Dermatol. 2006 Sep;126(9):2010-8.
• [23] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [24] Genomic integration and ligand-dependent activation of the human estrogen receptor in the crustacean Daphnia magna. PLoS One. 2018 Jun 8;13(6):e0198023. doi: 10.1371/journal.pone.0198023. eCollection 2018.
• [25] Analysis of the effects of different alcohols on MCF-7 human breast cancer cells. Ann N Y Acad Sci. 2004 Dec;1030:78-85. doi: 10.1196/annals.1329.010.
• [26] The vitamin A family can significantly decrease the expression of ERbeta of ERs positive breast cancer cells in the presence or absence of ER ligands and paclitaxel. Gynecol Endocrinol. 2009 May;25(5):287-93. doi: 10.1080/09513590802530924.
• [27] Endocrine disrupting activities and immunomodulatory effects in lymphoblastoid cell lines of diclofenac, 4-hydroxydiclofenac and paracetamol. Toxicol Lett. 2018 Sep 15;294:95-104. doi: 10.1016/j.toxlet.2018.05.022. Epub 2018 May 16.
• [28] Quantitative analysis of expression level of estrogen and progesterone receptors and VEGF genes in human endometrial stromal cells after treatment with nicotine. Toxicol Mech Methods. 2016 Oct;26(8):595-600. doi: 10.1080/15376516.2016.1218578. Epub 2016 Aug 23.
• [29] Tartrazine and sunset yellow are xenoestrogens in a new screening assay to identify modulators of human oestrogen receptor transcriptional activity. Toxicology. 2012 Aug 16;298(1-3):40-51. doi: 10.1016/j.tox.2012.04.014. Epub 2012 May 3.
• [30] Estrogenic activities of two synthetic pyrethroids and their metabolites. J Environ Sci (China). 2010;22(2):290-6. doi: 10.1016/s1001-0742(09)60107-8.
• [31] Prediction of the combined effects of multiple estrogenic chemicals on MCF-7 human breast cancer cells and a preliminary molecular exploration of the estrogenic proliferative effects and related gene expression. Ecotoxicol Environ Saf. 2018 Sep 30;160:1-9. doi: 10.1016/j.ecoenv.2018.05.025. Epub 2018 May 21.
• [32] Arsenic induces functional re-expression of estrogen receptor by demethylation of DNA in estrogen receptor-negative human breast cancer. PLoS One. 2012;7(4):e35957. doi: 10.1371/journal.pone.0035957. Epub 2012 Apr 27.
• [33] Quantitative high-throughput profiling of environmental chemicals and drugs that modulate farnesoid X receptor. Sci Rep. 2014 Sep 26;4:6437. doi: 10.1038/srep06437.
• [34] Influence of estradiol and triiodothyronine on breast cancer cell lines proliferation and expression of estrogen and thyroid hormone receptors. Arq Bras Endocrinol Metabol. 2009 Oct;53(7):859-64. doi: 10.1590/s0004-27302009000700010.
• [35] Bidirectional cross talk between ERalpha and EGFR signalling pathways regulates tamoxifen-resistant growth. Breast Cancer Res Treat. 2006 Mar;96(2):131-46. doi: 10.1007/s10549-005-9070-2. Epub 2005 Oct 27.
• [36] Effects of HIV protease inhibitor ritonavir on Akt-regulated cell proliferation in breast cancer. Clin Cancer Res. 2006 Mar 15;12(6):1883-96. doi: 10.1158/1078-0432.CCR-05-1167.
• [37] Prostaglandin E2 induces CYP1B1 expression via ligand-independent activation of the ERalpha pathway in human breast cancer cells. Toxicol Sci. 2010 Apr;114(2):204-16.
• [38] Melatonin decreases estrogen receptor binding to estrogen response elements sites on the OCT4 gene in human breast cancer stem cells. Genes Cancer. 2016 May;7(5-6):209-17. doi: 10.18632/genesandcancer.107.
• [39] Estrogenic Effects of the Extracts from the Chinese Yam (Dioscorea opposite Thunb.) and Its Effective Compounds in Vitro and in Vivo. Molecules. 2018 Jan 23;23(2):11. doi: 10.3390/molecules23020011.
• [40] A binary screening assay for pro-oestrogens in food: metabolic activation using hepatic microsomes and detection with oestrogen sensitive recombinant yeast cells. Food Addit Contam. 2002 Dec;19(12):1138-47. doi: 10.1080/0265203021000014789.
• [41] Expression of estrogen and progesterone receptor genes in endometrium, myometrium and vagina of postmenopausal women treated with estriol. Sao Paulo Med J. 2009;127(3):128-33. doi: 10.1590/s1516-31802009000300004.
• [42] Development of a recombinant human ovarian (BG1) cell line containing estrogen receptor and for improved detection of estrogenic/antiestrogenic chemicals. Environ Toxicol Chem. 2016 Jan;35(1):91-100. doi: 10.1002/etc.3146. Epub 2015 Dec 9.
• [43] The dual ErbB1/ErbB2 inhibitor, lapatinib (GW572016), cooperates with tamoxifen to inhibit both cell proliferation- and estrogen-dependent gene expression in antiestrogen-resistant breast cancer. Cancer Res. 2005 Jan 1;65(1):18-25.
• [44] Dehydroepiandrosterone Activation of G-protein-coupled Estrogen Receptor Rapidly Stimulates MicroRNA-21 Transcription in Human Hepatocellular Carcinoma Cells. J Biol Chem. 2015 Jun 19;290(25):15799-15811. doi: 10.1074/jbc.M115.641167. Epub 2015 May 11.
• [45] Arylpiperazines for management of benign prostatic hyperplasia: design, synthesis, quantitative structure-activity relationships, and pharmacokinetic studies. J Med Chem. 2011 Jan 13;54(1):302-11. doi: 10.1021/jm101163m. Epub 2010 Dec 3.
• [46] Estrogenic effects of natural and synthetic compounds including tibolone assessed in Saccharomyces cerevisiae expressing the human estrogen alpha and beta receptors. FASEB J. 2006 Jul;20(9):1552-4. doi: 10.1096/fj.05-5413fje. Epub 2006 May 23.
• [47] A phase I study of hydralazine to demethylate and reactivate the expression of tumor suppressor genes. BMC Cancer. 2005 Apr 29;5:44.
• [48] Structure-activity relationships for a family of benzothiophene selective estrogen receptor modulators including raloxifene and arzoxifene. ChemMedChem. 2007 Oct;2(10):1520-6. doi: 10.1002/cmdc.200700104.
• [49] A comparative study of the effect of raloxifene and gosereline on uterine leiomyoma volume changes and estrogen receptor, progesterone receptor, bcl-2 and p53 expression immunohistochemically in premenopausal women. Eur J Obstet Gynecol Reprod Biol. 2007 Nov;135(1):94-103. doi: 10.1016/j.ejogrb.2006.07.042. Epub 2006 Sep 14.
• [50] Profiling of the Tox21 10K compound library for agonists and antagonists of the estrogen receptor alpha signaling pathway. Sci Rep. 2014 Jul 11;4:5664. doi: 10.1038/srep05664.
• [51] Mixture Effects of Bisphenol A and Its Structural Analogs on Estrogen Receptor Transcriptional Activation. Toxics. 2023 Dec 4;11(12):986. doi: 10.3390/toxics11120986.
• [52] Identification of Compounds That Inhibit Estrogen-Related Receptor Alpha Signaling Using High-Throughput Screening Assays. Molecules. 2019 Feb 27;24(5):841. doi: 10.3390/molecules24050841.
• [53] Antitumoral activity of liraglutide, a new DNMT inhibitor in breast cancer cells in vitro and in vivo. Chem Biol Interact. 2021 Nov 1;349:109641. doi: 10.1016/j.cbi.2021.109641. Epub 2021 Sep 14.
• [54] Effects of ospemifene, a novel selective estrogen-receptor modulator, on human breast tissue ex vivo. Menopause. 2016 Jul;23(7):719-30. doi: 10.1097/GME.0000000000000624.
• [55] Optimization of a yeast estrogen screen and its applicability to study the release of estrogenic isoflavones from a soygerm powder. Environ Health Perspect. 2001 Jul;109(7):691-7. doi: 10.1289/ehp.01109691.
• [56] 4-(E)-{(p-tolylimino)-methylbenzene-1,2-diol}, 1 a novel resveratrol analog, differentially regulates estrogen receptors and in breast cancer cells. Toxicol Appl Pharmacol. 2016 Jun 15;301:1-13. doi: 10.1016/j.taap.2016.03.003. Epub 2016 Mar 9.
• [57] Curcumin (diferuloylmethane) alters the expression profiles of microRNAs in human pancreatic cancer cells. Mol Cancer Ther. 2008 Mar;7(3):464-73. doi: 10.1158/1535-7163.MCT-07-2272.
• [58] 1-Benzyl-indole-3-carbinol is a novel indole-3-carbinol derivative with significantly enhanced potency of anti-proliferative and anti-estrogenic properties in human breast cancer cells. Chem Biol Interact. 2010 Aug 5;186(3):255-66. doi: 10.1016/j.cbi.2010.05.015. Epub 2010 Jun 2.
• [59] Sulindac sulfide and exisulind inhibit expression of the estrogen and progesterone receptors in human breast cancer cells. Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3478-84. doi: 10.1158/1078-0432.CCR-05-2051.
• [60] Oral administration of Brazilian propolis exerts estrogenic effect in ovariectomized rats. J Toxicol Sci. 2015 Apr;40(2):235-42. doi: 10.2131/jts.40.235.
• [61] Antiestrogenic effects of the novel sphingosine kinase-2 inhibitor ABC294640. Endocrinology. 2010 Nov;151(11):5124-35. doi: 10.1210/en.2010-0420. Epub 2010 Sep 22.
• [62] Gene profiles of THP-1 macrophages after in vitro exposure to respiratory (non-)sensitizing chemicals: identification of discriminating genetic markers and pathway analysis. Toxicol In Vitro. 2009 Sep;23(6):1151-62. doi: 10.1016/j.tiv.2009.06.007. Epub 2009 Jun 13.
• [63] Xenoestrogens and the induction of proliferative effects in breast cancer cells via direct activation of oestrogen receptor alpha. Food Addit Contam. 2004 Feb;21(2):134-44. doi: 10.1080/02652030310001641177.
• [64] 12-O-tetradecanoylphorbol-13-acetate upregulates the Ah receptor and differentially alters CYP1B1 and CYP1A1 expression in MCF-7 breast cancer cells. J Cell Biochem. 1998 Sep 1;70(3):289-96.
• [65] Mechanism analysis of Buyang Huanwu decoction in treating atherosclerosis based on network pharmacology and in?vitro experiments. Chem Biol Drug Des. 2024 Jan;103(1):e14447. doi: 10.1111/cbdd.14447.
• [66] The tamoxifen metabolite, endoxifen, is a potent antiestrogen that targets estrogen receptor alpha for degradation in breast cancer cells. Cancer Res. 2009 Mar 1;69(5):1722-7. doi: 10.1158/0008-5472.CAN-08-3933. Epub 2009 Feb 24.
• [67] Estrogenic/antiestrogenic activities of a Epimedium koreanum extract and its major components: in vitro and in vivo studies. Food Chem Toxicol. 2012 Aug;50(8):2751-9. doi: 10.1016/j.fct.2012.05.017. Epub 2012 May 18.
• [68] Structure-based Identification of Endocrine Disrupting Pesticides Targeting Breast Cancer Proteins. Toxicology. 2020 Jun;439:152459. doi: 10.1016/j.tox.2020.152459. Epub 2020 Apr 9.
• [69] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [70] Inhibition of BET proteins impairs estrogen-mediated growth and transcription in breast cancers by pausing RNA polymerase advancement. Breast Cancer Res Treat. 2015 Apr;150(2):265-78. doi: 10.1007/s10549-015-3319-1. Epub 2015 Feb 27.
• [71] An epigenomic approach to therapy for tamoxifen-resistant breast cancer. Cell Res. 2014 Jul;24(7):809-19. doi: 10.1038/cr.2014.71. Epub 2014 May 30.
• [72] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [73] Assessment of estrogenic activity in some common essential oil constituents. J Pharm Pharmacol. 2002 Nov;54(11):1521-8. doi: 10.1211/002235702216.
• [74] Recombinant human estrogen, androgen and progesterone receptors for detection of potential endocrine disruptors. Anal Bioanal Chem. 2004 Feb;378(3):664-9. doi: 10.1007/s00216-003-2251-0. Epub 2003 Oct 25.
• [75] Towards high-throughput identification of endocrine disrupting compounds with mass spectrometry. Toxicol In Vitro. 2009 Jun;23(4):704-9. doi: 10.1016/j.tiv.2009.02.004. Epub 2009 Feb 20.
• [76] Androgen- and estrogen-receptor mediated activities of 4-hydroxytestosterone, 4-hydroxyandrostenedione and their human metabolites in yeast based assays. Toxicol Lett. 2018 Aug;292:39-45. doi: 10.1016/j.toxlet.2018.04.026. Epub 2018 Apr 24.
• [77] Destabilization of steroid receptors by heat shock protein 90-binding drugs: a ligand-independent approach to hormonal therapy of breast cancer. Clin Cancer Res. 2001 Jul;7(7):2076-84.
• [78] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [79] Dioscin promotes osteoblastic proliferation and differentiation via Lrp5 and ER pathway in mouse and human osteoblast-like cell lines. J Biomed Sci. 2014 Apr 17;21(1):30. doi: 10.1186/1423-0127-21-30.
• [80] LC, a novel estrone-rhein hybrid compound, promotes proliferation and differentiation and protects against cell death in human osteoblastic MG-63 cells. Mol Cell Endocrinol. 2011 Sep 15;344(1-2):59-68. doi: 10.1016/j.mce.2011.06.027. Epub 2011 Jul 13.
• [81] A functional polymorphism in estrogen receptor alpha gene is associated with Japanese methamphetamine induced psychosis. Prog Neuropsychopharmacol Biol Psychiatry. 2009 Aug 1;33(5):895-8. doi: 10.1016/j.pnpbp.2009.04.008. Epub 2009 Apr 19.
• [82] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.