Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM189TA)

• DOT Name: C-X-C motif chemokine 14 (CXCL14)
• Synonyms: Chemokine BRAK; MIP-2G; Small-inducible cytokine B14
• Gene Name: CXCL14
• Related Disease:
  Adenocarcinoma
  Chronic obstructive pulmonary disease
  Lung adenocarcinoma
  Adult glioblastoma
  Advanced cancer
  Arteriosclerosis
  Asthma
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Carcinoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Drug dependence
  Endometriosis
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Immunodeficiency
  Inflammatory bowel disease
  Non-small-cell lung cancer
  Pancreatic cancer
  Pancreatic tumour
  Prostate carcinoma
  Prostate neoplasm
  Squamous cell carcinoma
  Stomach cancer
  Stroke
  Substance abuse
  Substance dependence
  Systemic sclerosis
  Thyroid gland papillary carcinoma
  Ulcerative colitis
  Bone osteosarcoma
  Lung carcinoma
  Non-insulin dependent diabetes
  Obesity
  Osteosarcoma
  Contact dermatitis
  Lung cancer
  Lung neoplasm
  Metastatic malignant neoplasm
  Prostate cancer
  Thyroid tumor
• UniProt ID: CXL14_HUMAN
• PDB ID: 2HDL
• Pfam ID: PF00048
• Sequence:
  MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
  PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
• Function: Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
• Tissue Specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Definitive	Altered Expression	[1]
Chronic obstructive pulmonary disease	DISQCIRF	Definitive	Altered Expression	[1]
Lung adenocarcinoma	DISD51WR	Definitive	Altered Expression	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[4]
Asthma	DISW9QNS	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Carcinoma	DISH9F1N	Strong	Biomarker	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Altered Expression	[9]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Drug dependence	DIS9IXRC	Strong	Biomarker	[11]
Endometriosis	DISX1AG8	Strong	Altered Expression	[12]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[13]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Glioma	DIS5RPEH	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[15]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[16]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[18]
Pancreatic cancer	DISJC981	Strong	Biomarker	[19]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[19]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[2]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[1]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[13]
Stroke	DISX6UHX	Strong	Biomarker	[21]
Substance abuse	DIS327VW	Strong	Biomarker	[11]
Substance dependence	DISDRAAR	Strong	Biomarker	[11]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[22]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[23]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[24]
Bone osteosarcoma	DIST1004	moderate	Altered Expression	[25]
Lung carcinoma	DISTR26C	moderate	Biomarker	[26]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Biomarker	[27]
Obesity	DIS47Y1K	moderate	Biomarker	[27]
Osteosarcoma	DISLQ7E2	moderate	Altered Expression	[25]
Contact dermatitis	DISQ3AU0	Limited	Biomarker	[28]
Lung cancer	DISCM4YA	Limited	Biomarker	[26]
Lung neoplasm	DISVARNB	Limited	Therapeutic	[29]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[30]
Prostate cancer	DISF190Y	Limited	Altered Expression	[20]
Thyroid tumor	DISLVKMD	Limited	Biomarker	[31]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of C-X-C motif chemokine 14 (CXCL14).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C-X-C motif chemokine 14 (CXCL14).	[45]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of C-X-C motif chemokine 14 (CXCL14).	[34]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of C-X-C motif chemokine 14 (CXCL14).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[37]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of C-X-C motif chemokine 14 (CXCL14).	[38]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of C-X-C motif chemokine 14 (CXCL14).	[29]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[40]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of C-X-C motif chemokine 14 (CXCL14).	[41]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of C-X-C motif chemokine 14 (CXCL14).	[38]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[42]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of C-X-C motif chemokine 14 (CXCL14).	[43]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[44]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of C-X-C motif chemokine 14 (CXCL14).	[38]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[36]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[46]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of C-X-C motif chemokine 14 (CXCL14).	[42]
Manganese	DMKT129	Investigative	Manganese increases the expression of C-X-C motif chemokine 14 (CXCL14).	[47]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of C-X-C motif chemokine 14 (CXCL14).	[48]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of C-X-C motif chemokine 14 (CXCL14).	[49]
PD98059	DMZC90M	Investigative	PD98059 increases the expression of C-X-C motif chemokine 14 (CXCL14).	[42]

References

• [1] Smoking-induced CXCL14 expression in the human airway epithelium links chronic obstructive pulmonary disease to lung cancer.Am J Respir Cell Mol Biol. 2013 Sep;49(3):418-25. doi: 10.1165/rcmb.2012-0396OC.
• [2] The Expression of the Chemokine CXCL14 Correlates with Several Aggressive Aspects of Glioblastoma and Promotes Key Properties of Glioblastoma Cells.Int J Mol Sci. 2019 May 21;20(10):2496. doi: 10.3390/ijms20102496.
• [3] A Novel Autocrine CXCL14/ACKR2 Axis: The Achilles' Heel of Cancer Metastasis?.Clin Cancer Res. 2019 Jun 15;25(12):3476-3478. doi: 10.1158/1078-0432.CCR-19-0853. Epub 2019 Apr 5.
• [4] Foam Cell-Derived CXCL14 Muti-Functionally Promotes Atherogenesis and Is a Potent Therapeutic Target in Atherosclerosis.J Cardiovasc Transl Res. 2020 Apr;13(2):215-224. doi: 10.1007/s12265-019-09915-z. Epub 2019 Nov 14.
• [5] Association between ORMDL3, IL1RL1 and a deletion on chromosome 17q21 with asthma risk in Australia.Eur J Hum Genet. 2011 Apr;19(4):458-64. doi: 10.1038/ejhg.2010.191. Epub 2010 Dec 8.
• [6] A Novel ACKR2-Dependent Role of Fibroblast-Derived CXCL14 in Epithelial-to-Mesenchymal Transition and Metastasis of Breast Cancer.Clin Cancer Res. 2019 Jun 15;25(12):3702-3717. doi: 10.1158/1078-0432.CCR-18-1294. Epub 2019 Mar 8.
• [7] Expression of p270 (ARID1A), a component of human SWI/SNF complexes, in human tumors.Int J Cancer. 2004 Nov 20;112(4):636. doi: 10.1002/ijc.20450.
• [8] Elevated S100A6 (Calcyclin) enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.Oncotarget. 2015 Mar 30;6(9):6656-69. doi: 10.18632/oncotarget.3169.
• [9] The Chemokine CXCL16 Is a New Biomarker for Lymph Node Analysis of Colon Cancer Outcome.Int J Mol Sci. 2019 Nov 18;20(22):5793. doi: 10.3390/ijms20225793.
• [10] Expression and effect of CXCL14 in colorectal carcinoma.Mol Med Rep. 2014 Sep;10(3):1561-8. doi: 10.3892/mmr.2014.2343. Epub 2014 Jun 17.
• [11] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [12] Molecular evaluation of proliferative-phase endometrium may provide insight about the underlying causes of infertility in women with endometriosis.Arch Gynecol Obstet. 2014 May;289(5):1119-24. doi: 10.1007/s00404-013-3103-6. Epub 2013 Nov 30.
• [13] Abnormal hypermethylation of promoter region downregulates chemokine CXC ligand 14 expression in gastric cancer.Int J Oncol. 2013 Nov;43(5):1487-94. doi: 10.3892/ijo.2013.2078. Epub 2013 Aug 23.
• [14] Long non-coding RNA UCA1/miR-182/PFKFB2 axis modulates glioblastoma-associated stromal cells-mediated glycolysis and invasion of glioma cells.Biochem Biophys Res Commun. 2018 Jun 7;500(3):569-576. doi: 10.1016/j.bbrc.2018.04.091. Epub 2018 Apr 25.
• [15] Suppressed Expression of CXCL14 in Hepatocellular Carcinoma Tissues and Its Reduction in the Advanced Stage of Chronic HBV Infection.Cancer Manag Res. 2019 Dec 12;11:10435-10443. doi: 10.2147/CMAR.S220528. eCollection 2019.
• [16] C-X-C Motif Chemokine Ligand 14 is a Unique Multifunctional Regulator of Tumor Progression.Int J Mol Sci. 2019 Apr 16;20(8):1872. doi: 10.3390/ijms20081872.
• [17] Genetic Risk for Inflammatory Bowel Disease Is a Determinant of Crohn's Disease Development in Chronic Granulomatous Disease.Inflamm Bowel Dis. 2016 Dec;22(12):2794-2801. doi: 10.1097/MIB.0000000000000966.
• [18] CXCL14 and NOS1 expression in specimens from patients with stage I-IIIA nonsmall cell lung cancer after curative resection.Medicine (Baltimore). 2018 Mar;97(10):e0101. doi: 10.1097/MD.0000000000010101.
• [19] CXCL14 expression and potential function in pancreatic cancer.Cancer Lett. 2008 Feb 8;259(2):209-17. doi: 10.1016/j.canlet.2007.10.021. Epub 2007 Nov 28.
• [20] CXCL14 is an autocrine growth factor for fibroblasts and acts as a multi-modal stimulator of prostate tumor growth.Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3414-9. doi: 10.1073/pnas.0813144106. Epub 2009 Feb 13.
• [21] A Crucial Role of CXCL14 for Promoting Regulatory T Cells Activation in Stroke.Theranostics. 2017 Feb 8;7(4):855-875. doi: 10.7150/thno.17558. eCollection 2017.
• [22] Possible association of decreased serum CXCL14 levels with digital ulcers in patients with systemic sclerosis.J Dermatol. 2019 Jul;46(7):584-589. doi: 10.1111/1346-8138.14914. Epub 2019 May 14.
• [23] Chemokine CXCL14 is associated with prognosis in patients with colorectal carcinoma after curative resection.J Transl Med. 2013 Jan 7;11:6. doi: 10.1186/1479-5876-11-6.
• [24] DNA methylation profile of genes involved in inflammation and autoimmunity in inflammatory bowel disease.Medicine (Baltimore). 2014 Dec;93(28):e309. doi: 10.1097/MD.0000000000000309.
• [25] The Expression of HSPD1, SCUBE3, CXCL14 and Its Relations with the Prognosis in Osteosarcoma.Cell Biochem Biophys. 2015 Dec;73(3):763-8. doi: 10.1007/s12013-015-0579-7.
• [26] Involvement of CXCL14 in osteolytic bone metastasis from lung cancer.Int J Oncol. 2014 Apr;44(4):1316-24. doi: 10.3892/ijo.2014.2293. Epub 2014 Feb 10.
• [27] CXCL14 Inhibits Insulin Secretion Independently of CXCR4 or CXCR7 Receptor Activation or cAMP Inhibition.Cell Physiol Biochem. 2019;52(4):879-892. doi: 10.33594/000000061.
• [28] Genes specifically modulated in sensitized skins allow the detection of sensitizers in a reconstructed human skin modelDevelopment of the SENS-IS assay. Toxicol In Vitro. 2015 Jun;29(4):787-802.
• [29] Re-expression of CXCL14, a common target for epigenetic silencing in lung cancer, induces tumor necrosis. Oncogene. 2010 Sep 16;29(37):5159-70. doi: 10.1038/onc.2010.255. Epub 2010 Jun 21.
• [30] CXCL14, CXCR7 expression and CXCR4 splice variant ratio associate with survival and metastases in Ewing sarcoma patients.Eur J Cancer. 2015 Nov;51(17):2624-33. doi: 10.1016/j.ejca.2015.08.020. Epub 2015 Sep 28.
• [31] Gene expression profiling of papillary thyroid carcinoma identifies transcripts correlated with BRAF mutational status and lymph node metastasis.Clin Cancer Res. 2008 Aug 1;14(15):4735-42. doi: 10.1158/1078-0432.CCR-07-4372.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [34] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [35] Gene expression profiling of human peri-implantation endometria between natural and stimulated cycles. Fertil Steril. 2008 Dec;90(6):2152-64.
• [36] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [37] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [38] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [39] Re-expression of CXCL14, a common target for epigenetic silencing in lung cancer, induces tumor necrosis. Oncogene. 2010 Sep 16;29(37):5159-70. doi: 10.1038/onc.2010.255. Epub 2010 Jun 21.
• [40] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [41] Progestin regulates chemokine (C-X-C motif) ligand 14 transcript level in human endometrium. Mol Hum Reprod. 2010 Mar;16(3):170-7. doi: 10.1093/molehr/gap100. Epub 2009 Nov 10.
• [42] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [43] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [44] Regulation of gene expression and inhibition of experimental prostate cancer bone metastasis by dietary genistein. Neoplasia. 2004 Jul-Aug;6(4):354-63. doi: 10.1593/neo.03478.
• [45] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [46] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [47] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [48] The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
• [49] Differential effects of nitro-PAHs and amino-PAHs on cytokine and chemokine responses in human bronchial epithelial BEAS-2B cells. Toxicol Appl Pharmacol. 2010 Feb 1;242(3):270-80. doi: 10.1016/j.taap.2009.10.017. Epub 2009 Oct 29.