Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNML6UP)

• DOT Name: Hsc70-interacting protein (ST13)
• Synonyms: Hip; Aging-associated protein 2; Progesterone receptor-associated p48 protein; Protein FAM10A1; Putative tumor suppressor ST13; Renal carcinoma antigen NY-REN-33; Suppression of tumorigenicity 13 protein
• Gene Name: ST13
• Related Disease:
  Glioma
  Advanced cancer
  Alzheimer disease
  Amyloidosis
  Anemia
  Atrial fibrillation
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Carcinoma
  Cardiovascular disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Dementia
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Head and neck cancer
  Head and neck carcinoma
  Hepatitis C virus infection
  Influenza
  Liver cancer
  Lung cancer
  Lung carcinoma
  Major depressive disorder
  Matthew-Wood syndrome
  Melanoma
  Neoplasm
  Non-small-cell lung cancer
  Obesity
  Pancreatitis
  Promyelocytic leukaemia
  Small lymphocytic lymphoma
  Squamous cell carcinoma
  Stomach cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Transitional cell carcinoma
  Adenocarcinoma
  Adult glioblastoma
  Colorectal neoplasm
  Asthma
  Hyperglycemia
  Non-insulin dependent diabetes
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Type-1/2 diabetes
• UniProt ID: F10A1_HUMAN
• Pfam ID: PF18253 ; PF17830 ; PF13181
• Sequence:
  MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKP
  DSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVA
  AIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPD
  SAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
  KREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGM
  GGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISK
  LSAKFGGQA
• Function: One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of HSC70 with various target proteins.
• Reactome Pathway: Regulation of HSF1-mediated heat shock response (R-HSA-3371453)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Amyloidosis	DISHTAI2	Strong	Biomarker	[4]
Anemia	DISTVL0C	Strong	Biomarker	[5]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Altered Expression	[9]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[10]
Colon cancer	DISVC52G	Strong	Biomarker	[11]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[12]
Dementia	DISXL1WY	Strong	Biomarker	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[14]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[15]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[16]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[17]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[17]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[18]
Influenza	DIS3PNU3	Strong	Biomarker	[19]
Liver cancer	DISDE4BI	Strong	Altered Expression	[20]
Lung cancer	DISCM4YA	Strong	Biomarker	[21]
Lung carcinoma	DISTR26C	Strong	Biomarker	[21]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[7]
Matthew-Wood syndrome	DISA7HR7	Strong	Genetic Variation	[22]
Melanoma	DIS1RRCY	Strong	Biomarker	[23]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[24]
Obesity	DIS47Y1K	Strong	Biomarker	[25]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[26]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[27]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[28]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[14]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[15]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[9]
Thyroid tumor	DISLVKMD	Strong	Altered Expression	[9]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[29]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[30]
Adult glioblastoma	DISVP4LU	moderate	Altered Expression	[16]
Colorectal neoplasm	DISR1UCN	moderate	Altered Expression	[30]
Asthma	DISW9QNS	Limited	Genetic Variation	[31]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[32]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[33]
Parkinson disease	DISQVHKL	Limited	Biomarker	[34]
Prostate cancer	DISF190Y	Limited	Altered Expression	[35]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[35]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[32]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Hsc70-interacting protein (ST13).	[36]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Hsc70-interacting protein (ST13).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Hsc70-interacting protein (ST13).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Hsc70-interacting protein (ST13).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Hsc70-interacting protein (ST13).	[40]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Hsc70-interacting protein (ST13).	[41]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Hsc70-interacting protein (ST13).	[42]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid increases the expression of Hsc70-interacting protein (ST13).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Hsc70-interacting protein (ST13).	[44]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Hsc70-interacting protein (ST13).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Hsc70-interacting protein (ST13).	[46]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Hsc70-interacting protein (ST13).	[47]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Hsc70-interacting protein (ST13).	[48]

References

• [1] Negative regulation of p53 by the long isoform of ErbB3 binding protein Ebp1 in brain tumors.Cancer Res. 2010 Dec 1;70(23):9730-41. doi: 10.1158/0008-5472.CAN-10-1882. Epub 2010 Nov 23.
• [2] The discovery of potent and stable short peptide FGFR1 antagonist for cancer therapy.Eur J Pharm Sci. 2020 Feb 15;143:105179. doi: 10.1016/j.ejps.2019.105179. Epub 2019 Dec 10.
• [3] Apolipoprotein E 4 Specifically Modulates the Hippocampus Functional Connectivity Network in Patients With Amnestic Mild Cognitive Impairment.Front Aging Neurosci. 2018 Sep 27;10:289. doi: 10.3389/fnagi.2018.00289. eCollection 2018.
• [4] Diabetic microcirculatory disturbances and pathologic erythropoiesis are provoked by deposition of amyloid-forming amylin in red blood cells and capillaries.Kidney Int. 2020 Jan;97(1):143-155. doi: 10.1016/j.kint.2019.07.028. Epub 2019 Sep 5.
• [5] Later puberty onset among chronically undernourished adolescents living in a Karachi slum, Pakistan.Acta Paediatr. 2020 May;109(5):1019-1025. doi: 10.1111/apa.15053. Epub 2019 Oct 30.
• [6] Amino Acid-Based Metabolic Panel Provides Robust Prognostic Value Additive to B-Natriuretic Peptide and Traditional Risk Factors in Heart Failure.Dis Markers. 2018 Oct 10;2018:3784589. doi: 10.1155/2018/3784589. eCollection 2018.
• [7] Common and distinct abnormal frontal-limbic system structural and functional patterns in patients with major depression and bipolar disorder.Neuroimage Clin. 2018 Jul 6;20:42-50. doi: 10.1016/j.nicl.2018.07.002. eCollection 2018.
• [8] Development of Thiazole-5-carboxylate Derivatives as Selective Inhibitors of Monoacylglycerol Lipase as Target in Cancer.Mini Rev Med Chem. 2019;19(5):410-423. doi: 10.2174/1389557518666180702103542.
• [9] Overexpression of the HIP gene coding for a heparin/heparan sulfate-binding protein in human thyroid carcinomas.Cancer Res. 1998 Oct 15;58(20):4745-51.
• [10] Day-by-Day Variability of Home Blood Pressure and Incident Cardiovascular Disease in Clinical Practice: The J-HOP Study (Japan Morning Surge-Home Blood Pressure).Hypertension. 2018 Jan;71(1):177-184. doi: 10.1161/HYPERTENSIONAHA.117.10385. Epub 2017 Nov 13.
• [11] Differential coupling of the PAC1 SV1 splice variant on human colonic tumors to the activation of intracellular cAMP but not intracellular Ca2+ does not activate tumor proliferation.J Mol Neurosci. 2004;22(1-2):83-92. doi: 10.1385/JMN:22:1-2:83.
• [12] ST13, a proliferation regulator, inhibits growth and migration of colorectal cancer cell lines.J Zhejiang Univ Sci B. 2012 Nov;13(11):884-93. doi: 10.1631/jzus.B1200037.
• [13] Amyloid deposition and brain structure as long-term predictors of MCI, dementia, and mortality.Neurology. 2018 May 22;90(21):e1920-e1928. doi: 10.1212/WNL.0000000000005549. Epub 2018 Apr 25.
• [14] HOP/OB1/NECC1 promoter DNA is frequently hypermethylated and involved in tumorigenic ability in esophageal squamous cell carcinoma.Mol Cancer Res. 2008 Jan;6(1):31-41. doi: 10.1158/1541-7786.MCR-07-0213.
• [15] HSP70/HSP90-Organizing Protein Contributes to Gastric Cancer Progression in an Autocrine Fashion and Predicts Poor Survival in Gastric Cancer.Cell Physiol Biochem. 2018;47(2):879-892. doi: 10.1159/000490080. Epub 2018 May 22.
• [16] EBP1 protein modulates the expression of human MHC class II molecules in non-hematopoietic cancer cells.Int J Oncol. 2015 Aug;47(2):481-9. doi: 10.3892/ijo.2015.3051. Epub 2015 Jun 16.
• [17] Carboxy-terminus Hsc70 interacting protein exerts a tumor inhibition function in head and neck cancer.Oncol Rep. 2017 Sep;38(3):1629-1636. doi: 10.3892/or.2017.5827. Epub 2017 Jul 17.
• [18] Modulation of HCV replication and translation by ErbB3 binding protein1 isoforms.Virology. 2017 Jan;500:35-49. doi: 10.1016/j.virol.2016.10.006. Epub 2016 Oct 19.
• [19] Investigation of the potential of a 48 kDa protein as a vaccine candidate for infection against nontypable Haemophilus influenzae.Vaccine. 2007 May 16;25(20):4012-9. doi: 10.1016/j.vaccine.2007.02.048. Epub 2007 Mar 8.
• [20] The human HIP gene, overexpressed in primary liver cancer encodes for a C-type carbohydrate binding protein with lactose binding activity.FEBS Lett. 1994 Jan 3;337(1):114-8. doi: 10.1016/0014-5793(94)80640-3.
• [21] The E3 Ligase CHIP Mediates p21 Degradation to Maintain Radioresistance.Mol Cancer Res. 2017 Jun;15(6):651-659. doi: 10.1158/1541-7786.MCR-16-0466. Epub 2017 Feb 23.
• [22] A pipeline for rapidly generating genetically engineered mouse models of pancreatic cancer using in vivo CRISPR-Cas9-mediated somatic recombination.Lab Invest. 2019 Jul;99(8):1233-1244. doi: 10.1038/s41374-018-0171-z. Epub 2019 Feb 6.
• [23] Expression analysis of genes identified by molecular profiling of VGP melanomas and MGP melanoma-positive lymph nodes.Cancer Biol Ther. 2004 Jan;3(1):110-20. doi: 10.4161/cbt.3.1.662. Epub 2004 Jan 24.
• [24] Targeting proprotein convertases in furin-rich lung cancer cells results in decreased in vitro and in vivo growth.Mol Carcinog. 2017 Mar;56(3):1182-1188. doi: 10.1002/mc.22550. Epub 2016 Sep 22.
• [25] PAP/HIP protein is an obesogenic factor.J Cell Physiol. 2014 Feb;229(2):225-31. doi: 10.1002/jcp.24438.
• [26] Structural organization and chromosomal localization of a human gene (HIP/PAP) encoding a C-type lectin overexpressed in primary liver cancer.Eur J Biochem. 1994 Aug 15;224(1):29-38. doi: 10.1111/j.1432-1033.1994.tb19991.x.
• [27] Induction of leukemia cell differentiation and apoptosis by recombinant P48, a modulin derived from Mycoplasma fermentans.Biochem Biophys Res Commun. 2000 Mar 5;269(1):284-9. doi: 10.1006/bbrc.2000.2282.
• [28] RFP2, c13ORF1, and FAM10A4 are the most likely tumor suppressor gene candidates for B-cell chronic lymphocytic leukemia.Cancer Genet Cytogenet. 2003 Oct 1;146(1):48-57. doi: 10.1016/s0165-4608(03)00126-2.
• [29] Impaired alpha-interferon signaling in transitional cell carcinoma: lack of p48 expression in 5637 cells.Cancer Res. 2001 Mar 1;61(5):2261-6.
• [30] Expression of ST13 in colorectal cancer and adjacent normal tissues.World J Gastroenterol. 2005 Jan 21;11(3):336-9. doi: 10.3748/wjg.v11.i3.336.
• [31] ST13 polymorphisms and their effect on exacerbations in steroid-treated asthmatic children and young adults.Clin Exp Allergy. 2015 Jun;45(6):1051-9. doi: 10.1111/cea.12492.
• [32] Diabetes due to a progressive defect in beta-cell mass in rats transgenic for human islet amyloid polypeptide (HIP Rat): a new model for type 2 diabetes.Diabetes. 2004 Jun;53(6):1509-16. doi: 10.2337/diabetes.53.6.1509.
• [33] Lower sarcoplasmic reticulum Ca(2+) threshold for triggering afterdepolarizations in diabetic rat hearts.Heart Rhythm. 2019 May;16(5):765-772. doi: 10.1016/j.hrthm.2018.11.001. Epub 2018 Nov 7.
• [34] Molecular markers of early Parkinson's disease based on gene expression in blood.Proc Natl Acad Sci U S A. 2007 Jan 16;104(3):955-60. doi: 10.1073/pnas.0610204104. Epub 2007 Jan 10.
• [35] The heat shock protein 70 inhibitor VER155008 suppresses the expression of HSP27, HOP and HSP90 and the androgen receptor, induces apoptosis, and attenuates prostate cancer cell growth.J Cell Biochem. 2020 Jan;121(1):407-417. doi: 10.1002/jcb.29195. Epub 2019 Jun 21.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [42] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [43] Antineoplastic effects of gamma linolenic Acid on hepatocellular carcinoma cell lines. J Clin Biochem Nutr. 2010 Jul;47(1):81-90.
• [44] Differential expression of genes induced by resveratrol in LNCaP cells: P53-mediated molecular targets. Int J Cancer. 2003 Mar 20;104(2):204-12.
• [45] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [46] Epigenetic influences of low-dose bisphenol A in primary human breast epithelial cells. Toxicol Appl Pharmacol. 2010 Oct 15;248(2):111-21.
• [47] Lipid Rafts Disruption Increases Ochratoxin A Cytotoxicity to Hepatocytes. J Biochem Mol Toxicol. 2016 Feb;30(2):71-9. doi: 10.1002/jbt.21738. Epub 2015 Aug 25.
• [48] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.