Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQA0NV4)

• DOT Name: Glycodelin (PAEP)
• Synonyms: GD; Placental protein 14; PP14; Pregnancy-associated endometrial alpha-2 globulin; PAEG; PEG; Progestagen-associated endometrial protein; Progesterone-associated endometrial protein; Zona-binding inhibitory factor-1; ZIF-1
• Gene Name: PAEP
• Related Disease:
  Colon cancer
  Rheumatoid arthritis
  Advanced cancer
  Anemia
  Bone osteosarcoma
  Brain neoplasm
  Breast neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Colon carcinoma
  Colorectal carcinoma
  Endometrial cancer
  Endometrial carcinoma
  Endometriosis
  Epithelial ovarian cancer
  Gastric cancer
  Glioblastoma multiforme
  Hepatitis
  Hepatitis D virus infection
  Liver cancer
  Liver cirrhosis
  Major depressive disorder
  Melanoma
  Metastatic malignant neoplasm
  Non-small-cell lung cancer
  Osteoarthritis
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Plasma cell myeloma
  Rabies
  Stroke
  T-cell lymphoma
  Ulcerative colitis
  Anxiety
  Anxiety disorder
  Lung cancer
  Lung carcinoma
  Stomach cancer
  Adult glioblastoma
  Dementia
  Alzheimer disease
  Arrhythmia
  Chronic hepatitis B virus infection
  Cryohydrocytosis
  Neuroblastoma
  Prostate cancer
  Prostate carcinoma
  Triple negative breast cancer
• UniProt ID: PAEP_HUMAN
• PDB ID: 4R0B
• Pfam ID: PF00061
• Sequence:
  MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH
  ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF
  LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
• Function: Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. Glycodelin-C stimulates binding of spermatozoa to the zona pellucida. Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa. Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa.
• Tissue Specificity: This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy . Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and maternal serum (at protein level) . Glycodelin-F is expressed in follicular fluid, luteinized granulosa cells and the oviduct (at protein level) . Glycodelin-S is expressed in seminal plasma and seminal vesicles (at protein level) . Glycodelin-C is detected in cumulus cells (at protein level), but cumulus cells do not synthesize Glycodelin-C but take up and convert glycodelin-A and -F vis glycan remodeling .

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colon cancer	DISVC52G	Definitive	Biomarker	[1]
Rheumatoid arthritis	DISTSB4J	Definitive	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Anemia	DISTVL0C	Strong	Biomarker	[4]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[5]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[6]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[7]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[8]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[11]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[11]
Endometriosis	DISX1AG8	Strong	Biomarker	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
Gastric cancer	DISXGOUK	Strong	Biomarker	[14]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[15]
Hepatitis	DISXXX35	Strong	Genetic Variation	[16]
Hepatitis D virus infection	DISESSLZ	Strong	Biomarker	[17]
Liver cancer	DISDE4BI	Strong	Biomarker	[8]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[18]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[19]
Melanoma	DIS1RRCY	Strong	Biomarker	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[22]
Osteoarthritis	DIS05URM	Strong	Biomarker	[23]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[5]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[13]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Parkinson disease	DISQVHKL	Strong	Biomarker	[24]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[25]
Rabies	DISSC4V5	Strong	Biomarker	[26]
Stroke	DISX6UHX	Strong	Genetic Variation	[27]
T-cell lymphoma	DISSXRTQ	Strong	Genetic Variation	[28]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[29]
Anxiety	DISIJDBA	moderate	Biomarker	[30]
Anxiety disorder	DISBI2BT	moderate	Biomarker	[30]
Lung cancer	DISCM4YA	moderate	Biomarker	[31]
Lung carcinoma	DISTR26C	moderate	Biomarker	[31]
Stomach cancer	DISKIJSX	moderate	Biomarker	[32]
Adult glioblastoma	DISVP4LU	Disputed	Biomarker	[15]
Dementia	DISXL1WY	Disputed	Biomarker	[33]
Alzheimer disease	DISF8S70	Limited	Biomarker	[34]
Arrhythmia	DISFF2NI	Limited	Genetic Variation	[35]
Chronic hepatitis B virus infection	DISHL4NT	Limited	Biomarker	[36]
Cryohydrocytosis	DISMQHL3	Limited	Genetic Variation	[37]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[38]
Prostate cancer	DISF190Y	Limited	Biomarker	[39]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[39]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[40]

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Progesterone	DMUY35B	Approved	Glycodelin (PAEP) increases the abundance of Progesterone.	[53]
Hydrocortisone	DMGEMB7	Approved	Glycodelin (PAEP) increases the metabolism of Hydrocortisone.	[54]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Glycodelin (PAEP).	[41]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Glycodelin (PAEP).	[42]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Glycodelin (PAEP).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Glycodelin (PAEP).	[44]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Glycodelin (PAEP).	[45]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Glycodelin (PAEP).	[42]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Glycodelin (PAEP).	[46]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Glycodelin (PAEP).	[46]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Glycodelin (PAEP).	[47]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Glycodelin (PAEP).	[48]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Glycodelin (PAEP).	[49]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Glycodelin (PAEP).	[50]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Glycodelin (PAEP).	[51]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
1-anilinonaphthalene-8-sulfonic acid	DMNGY0E	Investigative	1-anilinonaphthalene-8-sulfonic acid affects the binding of Glycodelin (PAEP).	[52]

References

• [1] The effect of linker type and recognition peptide conjugation chemistry on tissue affinity and cytotoxicity of charged polyacrylamide.J Control Release. 2017 Jul 10;257:102-117. doi: 10.1016/j.jconrel.2016.06.038. Epub 2016 Jun 30.
• [2] Prolonged immunomodulation in inflammatory arthritis using the selective Kv1.3 channel blocker HsTX1[R14A] and its PEGylated analog.Clin Immunol. 2017 Jul;180:45-57. doi: 10.1016/j.clim.2017.03.014. Epub 2017 Apr 4.
• [3] Doxorubicin-Loaded Bi-PEG Nanoparticles as Novel Chemo-Photothermal Nanoagents for Efficiently Killing Cancer Cells.J Nanosci Nanotechnol. 2020 Apr 1;20(4):2032-2039. doi: 10.1166/jnn.2020.17212.
• [4] ITPA genetic variants influence efficacy of PEG-IFN/RBV therapy in older patients infected with HCV genotype 1 and favourable IL28B type.J Viral Hepat. 2014 Jul;21(7):466-74. doi: 10.1111/jvh.12171. Epub 2013 Sep 3.
• [5] Specific Small-Molecule NIR-II Fluorescence Imaging of Osteosarcoma and Lung Metastasis.Adv Healthc Mater. 2020 Jan;9(1):e1901224. doi: 10.1002/adhm.201901224. Epub 2019 Dec 3.
• [6] Integration of PEG 400 into a self-nanoemulsifying drug delivery system improves drug loading capacity and nasal mucosa permeability and prolongs the survival of rats with malignant brain tumors.Int J Nanomedicine. 2019 May 16;14:3601-3613. doi: 10.2147/IJN.S193617. eCollection 2019.
• [7] Microwave-Synthesized Platinum-Embedded Mesoporous Silica Nanoparticles as Dual-Modality Contrast Agents: Computed Tomography and Optical Imaging.Int J Mol Sci. 2019 Mar 28;20(7):1560. doi: 10.3390/ijms20071560.
• [8] Sorafenib-loaded hydroxyethyl starch-TG100-115 micelles for the treatment of liver cancer based on synergistic treatment.Drug Deliv. 2019 Dec;26(1):756-764. doi: 10.1080/10717544.2019.1642418.
• [9] Formulation and evaluation of anticancer and antiangiogenesis efficiency of PLA-PEG nanoparticles loaded with galbanic acid in C26 colon carcinoma, in vitro and in vivo.J Cell Physiol. 2019 May;234(5):6099-6107. doi: 10.1002/jcp.27346. Epub 2018 Oct 30.
• [10] Development of genistein-PEGylated silica hybrid nanomaterials with enhanced antioxidant and antiproliferative properties on HT29 human colon cancer cells.Am J Transl Res. 2018 Aug 15;10(8):2306-2323. eCollection 2018.
• [11] The Roles of Glycodelin in Cancer Development and Progression.Front Immunol. 2017 Nov 29;8:1685. doi: 10.3389/fimmu.2017.01685. eCollection 2017.
• [12] Proteomics in the Diagnosis of Endometriosis: Opportunities and Challenges.Proteomics Clin Appl. 2019 May;13(3):e1800183. doi: 10.1002/prca.201800183. Epub 2019 Jan 2.
• [13] Retro-inverso follicle-stimulating hormone peptide-mediated polyethylenimine complexes for targeted ovarian cancer gene therapy.Drug Deliv. 2018 Nov;25(1):995-1003. doi: 10.1080/10717544.2018.1461956.
• [14] Upregulation of Mir-34a in AGS Gastric Cancer Cells by a PLGA-PEG-PLGA Chrysin Nano Formulation.Asian Pac J Cancer Prev. 2015;16(18):8259-63. doi: 10.7314/apjcp.2015.16.18.8259.
• [15] Squalene-PEG: Pyropheophorbide-a nanoconstructs for tumor theranostics.Nanomedicine. 2019 Jan;15(1):243-251. doi: 10.1016/j.nano.2018.09.013. Epub 2018 Oct 7.
• [16] The relationship between ITPA rs1127354 polymorphisms and efficacy of antiviral treatment in Northeast Chinese CHC patients.Medicine (Baltimore). 2017 Jul;96(29):e7554. doi: 10.1097/MD.0000000000007554.
• [17] Screening for hepatitis D and PEG-Interferon over Tenofovir enhance general hepatitis control efforts in Brazil.PLoS One. 2018 Sep 7;13(9):e0203831. doi: 10.1371/journal.pone.0203831. eCollection 2018.
• [18] Peginterferon is preferable to entecavir for prevention of unfavourable events in patients with HBeAg-positive chronic hepatitis B: A five-year observational cohort study.J Viral Hepat. 2017 Nov;24 Suppl 1:12-20. doi: 10.1111/jvh.12755.
• [19] Usefulness of the 15-item geriatric depression scale (GDS-15) for classifying minor and major depressive disorders among community-dwelling elders.J Affect Disord. 2019 Dec 1;259:370-375. doi: 10.1016/j.jad.2019.08.053. Epub 2019 Aug 20.
• [20] Pembrolizumab Plus Pegylated Interferon alfa-2b or Ipilimumab for Advanced Melanoma or Renal Cell Carcinoma: Dose-Finding Results from the Phase Ib KEYNOTE-029 Study.Clin Cancer Res. 2018 Apr 15;24(8):1805-1815. doi: 10.1158/1078-0432.CCR-17-3436. Epub 2018 Jan 22.
• [21] Complexation of Chol-DsiRNA in place of Chol-siRNA greatly increases the duration of mRNA suppression by polyplexes of PLL(30)-PEG(5K) in primary murine syngeneic breast tumors after i.v. administration.Int J Pharm. 2018 May 30;543(1-2):130-138. doi: 10.1016/j.ijpharm.2018.03.045. Epub 2018 Mar 27.
• [22] Pathways regulating the expression of the immunomodulatory protein glycodelin in nonsmall cell lung cancer.Int J Oncol. 2019 Feb;54(2):515-526. doi: 10.3892/ijo.2018.4654. Epub 2018 Dec 5.
• [23] Thermosensitive hybrid hyaluronan/p(HPMAm-lac)-PEG hydrogels enhance cartilage regeneration in a mouse model of osteoarthritis.J Cell Physiol. 2019 Nov;234(11):20013-20027. doi: 10.1002/jcp.28598. Epub 2019 Apr 9.
• [24] Exploring white matter microstructure and olfaction dysfunction in early parkinson disease: diffusion MRI reveals new insight.Brain Imaging Behav. 2019 Feb;13(1):210-219. doi: 10.1007/s11682-017-9781-0.
• [25] Doxorubicin-Loaded PEG-CdTe Quantum Dots as a Smart Drug Delivery System for Extramedullary Multiple Myeloma Treatment.Nanoscale Res Lett. 2018 Nov 22;13(1):373. doi: 10.1186/s11671-018-2782-0.
• [26] Comparative Immunogenicity and Safety Trial of 2 Different Schedules of Single-visit Intradermal Rabies Postexposure Vaccination.Clin Infect Dis. 2019 Aug 16;69(5):797-804. doi: 10.1093/cid/ciy983.
• [27] Local delivery of stabilized chondroitinase ABC degrades chondroitin sulfate proteoglycans in stroke-injured rat brains.J Control Release. 2019 Mar 10;297:14-25. doi: 10.1016/j.jconrel.2019.01.033. Epub 2019 Jan 25.
• [28] PEG-L-CHOP treatment is safe and effective in adult extranodal NK/T-cell lymphoma with a low rate of clinical hypersensitivity.BMC Cancer. 2018 Sep 21;18(1):910. doi: 10.1186/s12885-018-4782-y.
• [29] Oral Targeted Delivery by Nanoparticles Enhances Efficacy of an Hsp90 Inhibitor by Reducing Systemic Exposure in Murine Models of Colitis and Colitis-Associated Cancer.J Crohns Colitis. 2020 Jan 1;14(1):130-141. doi: 10.1093/ecco-jcc/jjz113.
• [30] Anxiety and somatic symptoms among elderly patients with depression.Asian J Psychiatr. 2019 Mar;41:66-72. doi: 10.1016/j.ajp.2018.07.009. Epub 2018 Jul 18.
• [31] The Effects of Nanoencapsulated Curcumin-Fe3O4 on Proliferation and hTERT Gene Expression in Lung Cancer Cells.Anticancer Agents Med Chem. 2017;17(10):1363-1373. doi: 10.2174/1871520617666170213115756.
• [32] Evaluation of METase-pemetrexed-loaded PEG-PLGA nanoparticles modified with anti-CD133-scFV for treatment of gastric carcinoma.Biosci Rep. 2018 Jan 30;38(1):BSR20171001. doi: 10.1042/BSR20171001. Print 2018 Feb 28.
• [33] Neuropsychiatric symptoms as predictors of conversion from MCI to dementia: a machine learning approach.Int Psychogeriatr. 2020 Mar;32(3):381-392. doi: 10.1017/S1041610219001030.
• [34] Microenvironment Remodeling Micelles for Alzheimer's Disease Therapy by Early Modulation of Activated Microglia.Adv Sci (Weinh). 2018 Dec 12;6(4):1801586. doi: 10.1002/advs.201801586. eCollection 2019 Feb 20.
• [35] Cardiac autonomic functioning and post-traumatic stress: A preliminary study in youth at-risk for PTSD.Psychiatry Res. 2020 Feb;284:112684. doi: 10.1016/j.psychres.2019.112684. Epub 2019 Nov 7.
• [36] Peginterferon alfa-2a (40 kD) stopping rules in chronic hepatitis B: a systematic review and meta-analysis of individual participant data.Antivir Ther. 2019;24(2):133-140. doi: 10.3851/IMP3304.
• [37] Association of IL-28B, TBX21 gene polymorphisms and predictors of virological response for chronic hepatitis C.Arch Virol. 2018 May;163(5):1253-1262. doi: 10.1007/s00705-018-3750-9. Epub 2018 Feb 5.
• [38] Enhancement of Tumor Homing by Chemotherapy-Loaded Nanoparticles.Small. 2018 Nov;14(45):e1802886. doi: 10.1002/smll.201802886. Epub 2018 Oct 7.
• [39] Surface functionalized folate targeted oleuropein nano-liposomes for prostate tumor targeting: Invitro and invivo activity.Life Sci. 2019 Mar 1;220:136-146. doi: 10.1016/j.lfs.2019.01.053. Epub 2019 Jan 31.
• [40] Tumor-Targeting Micelles Based on Linear-Dendritic PEG-PTX(8) Conjugate for Triple Negative Breast Cancer Therapy.Mol Pharm. 2017 Oct 2;14(10):3409-3421. doi: 10.1021/acs.molpharmaceut.7b00430. Epub 2017 Aug 30.
• [41] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [44] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [45] Gene expression profiling of human peri-implantation endometria between natural and stimulated cycles. Fertil Steril. 2008 Dec;90(6):2152-64.
• [46] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [47] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [48] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [49] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [50] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [51] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [52] Comparative ligand-binding analysis of ten human lipocalins. Biochim Biophys Acta. 2006 Feb;1764(2):161-73. doi: 10.1016/j.bbapap.2005.12.006. Epub 2006 Jan 6.
• [53] [Stimulation of HCG, estrogen and progesterone production in isolated trophoblast cells by glycodelin A or its N-glycans]. Z Geburtshilfe Neonatol. 2005 Apr;209(2):59-64. doi: 10.1055/s-2005-864115.
• [54] Stimulation of progesterone, estradiol and cortisol in trophoblast tumor bewo cells by glycodelin A N-glycans. Anticancer Res. 2007 Jul-Aug;27(4A):2101-8.