Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVMMUOF)

• DOT Name: Paxillin (PXN)
• Gene Name: PXN
• Related Disease:
  B-cell neoplasm
  Hepatocellular carcinoma
  Adult glioblastoma
  Advanced cancer
  Benign prostatic hyperplasia
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Colorectal carcinoma
  Colorectal neoplasm
  Dilated cardiomyopathy 1A
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Head-neck squamous cell carcinoma
  Hepatitis C virus infection
  Lung adenocarcinoma
  Lung neoplasm
  Malignant glioma
  Neuroblastoma
  Non-small-cell lung cancer
  Osteosarcoma
  Ovarian neoplasm
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Renal cell carcinoma
  Small-cell lung cancer
  Stomach cancer
  Systemic sclerosis
  Breast neoplasm
  High blood pressure
  Invasive breast carcinoma
  Metastatic malignant neoplasm
  Adenocarcinoma
  Epithelial ovarian cancer
  Lung cancer
  Lung carcinoma
  Melanoma
• UniProt ID: PAXI_HUMAN
• PDB ID: 1OW6; 1OW7; 1OW8; 2K2R; 2O9V; 2VZD; 2VZG; 2VZI; 3GM1; 3PY7; 3RQE; 3RQF; 3RQG; 3U3F; 4EDN; 4R32; 4XGZ; 4XH2; 5UWH; 6IUI; 6PW8; 6U4M; 6U4N; 7QB0
• Pfam ID: PF00412 ; PF03535
• Sequence:
  MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
  TILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSF
  PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPL
  YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
  EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
  RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
  CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
  NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
  RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
  PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
• Function: Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Recruits other proteins such as TRIM15 to focal adhesion.
• KEGG Pathway:
  Chemokine sig.ling pathway (hsa04062)
  VEGF sig.ling pathway (hsa04370)
  Focal adhesion (hsa04510)
  Leukocyte transendothelial migration (hsa04670)
  Regulation of actin cytoskeleton (hsa04810)
  Bacterial invasion of epithelial cells (hsa05100)
  Shigellosis (hsa05131)
  Yersinia infection (hsa05135)
  Human cytomegalovirus infection (hsa05163)
  Human papillomavirus infection (hsa05165)
  Human immunodeficiency virus 1 infection (hsa05170)
  Viral carcinogenesis (hsa05203)
  Proteoglycans in cancer (hsa05205)
• Reactome Pathway:
  VEGFA-VEGFR2 Pathway (R-HSA-4420097)
  Smooth Muscle Contraction (R-HSA-445355)
  Localization of the PINCH-ILK-PARVIN complex to focal adhesions (R-HSA-446343)
  Regulation of cytoskeletal remodeling and cell spreading by IPP complex components (R-HSA-446388)
  PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases (R-HSA-8849471)
  GAB1 signalosome (R-HSA-180292)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Genetic Variation	[1]
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[5]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Carcinoma	DISH9F1N	Strong	Biomarker	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[9]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[10]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colonic neoplasm	DISSZ04P	Strong	Posttranslational Modification	[12]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[13]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[14]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[15]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[16]
Gastric cancer	DISXGOUK	Strong	Biomarker	[17]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[3]
Glioma	DIS5RPEH	Strong	Altered Expression	[3]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[18]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[19]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[20]
Lung neoplasm	DISVARNB	Strong	Biomarker	[21]
Malignant glioma	DISFXKOV	Strong	Altered Expression	[3]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[23]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[27]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[28]
Stomach cancer	DISKIJSX	Strong	Biomarker	[17]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[29]
Breast neoplasm	DISNGJLM	moderate	Altered Expression	[30]
High blood pressure	DISY2OHH	moderate	Altered Expression	[31]
Invasive breast carcinoma	DISANYTW	moderate	Posttranslational Modification	[32]
Metastatic malignant neoplasm	DIS86UK6	moderate	Posttranslational Modification	[33]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[20]
Epithelial ovarian cancer	DIS56MH2	Limited	Altered Expression	[34]
Lung cancer	DISCM4YA	Limited	Altered Expression	[35]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[35]
Melanoma	DIS1RRCY	Limited	Altered Expression	[36]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Paxillin (PXN).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Paxillin (PXN).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Paxillin (PXN).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Paxillin (PXN).	[40]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Paxillin (PXN).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Paxillin (PXN).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Paxillin (PXN).	[44]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Paxillin (PXN).	[45]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Paxillin (PXN).	[46]
Marinol	DM70IK5	Approved	Marinol increases the expression of Paxillin (PXN).	[47]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Paxillin (PXN).	[48]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Paxillin (PXN).	[50]
Isoflavone	DM7U58J	Phase 4	Isoflavone affects the expression of Paxillin (PXN).	[52]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Paxillin (PXN).	[53]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Paxillin (PXN).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Paxillin (PXN).	[57]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Paxillin (PXN).	[37]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the expression of Paxillin (PXN).	[58]

8 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Paxillin (PXN).	[43]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the phosphorylation of Paxillin (PXN).	[49]
Terbinafine	DMI6HUW	Approved	Terbinafine decreases the phosphorylation of Paxillin (PXN).	[51]
G1	DMTV42K	Phase 1/2	G1 increases the phosphorylation of Paxillin (PXN).	[54]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Paxillin (PXN).	[43]
NSC-87877	DMEYKXL	Patented	NSC-87877 increases the phosphorylation of Paxillin (PXN).	[56]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Paxillin (PXN).	[43]
[3H]oxotremorine-M	DM5L7D3	Investigative	[3H]oxotremorine-M increases the phosphorylation of Paxillin (PXN).	[60]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
toxaphene	DM4R657	Investigative	toxaphene increases the degradation of Paxillin (PXN).	[59]

References

• [1] Paxillin mutations affect focal adhesions and lead to altered mitochondrial dynamics: relevance to lung cancer.Cancer Biol Ther. 2013 Jul;14(7):679-91. doi: 10.4161/cbt.25091. Epub 2013 May 31.
• [2] Hydrogen peroxide inducible clone-5 mediates reactive oxygen species signaling for hepatocellular carcinoma progression.Oncotarget. 2015 Oct 20;6(32):32526-44. doi: 10.18632/oncotarget.5322.
• [3] Overexpression of Paxillin Correlates with Tumor Progression and Predicts Poor Survival in Glioblastoma.CNS Neurosci Ther. 2017 Jan;23(1):69-75. doi: 10.1111/cns.12606. Epub 2016 Sep 17.
• [4] Characterization of Hepatocellular Carcinoma Cell Lines Using a Fractionation-Then-Sequencing Approach Reveals Nuclear-Enriched HCC-Associated lncRNAs.Front Genet. 2019 Nov 8;10:1081. doi: 10.3389/fgene.2019.01081. eCollection 2019.
• [5] Increased Paxillin expression in prostate cancer is associated with advanced pathological features, lymph node metastases and biochemical recurrence.J Cancer. 2018 Feb 28;9(6):959-967. doi: 10.7150/jca.22787. eCollection 2018.
• [6] Tyrosine phosphorylation of paxillin affects the metastatic potential of human osteosarcoma.Oncogene. 2005 Jul 14;24(30):4754-64. doi: 10.1038/sj.onc.1208654.
• [7] (-)-Oleocanthal Combined with Lapatinib Treatment Synergized against HER-2 Positive Breast Cancer In Vitro and In Vivo.Nutrients. 2019 Feb 15;11(2):412. doi: 10.3390/nu11020412.
• [8] Contribution of the PI3K/MMPs/Ln-52 and EphA2/FAK/Paxillin signaling pathways to tumor growth and vasculogenic mimicry of gallbladder carcinomas.Int J Oncol. 2013 Jun;42(6):2103-15. doi: 10.3892/ijo.2013.1897. Epub 2013 Apr 15.
• [9] Expression of paxillin and FAK mRNA and the related clinical significance in esophageal carcinoma.Mol Med Rep. 2012 Feb;5(2):469-72. doi: 10.3892/mmr.2011.664. Epub 2011 Nov 4.
• [10] The overexpression of PXN promotes tumor progression and leads to radioresistance in cervical cancer.Future Oncol. 2018 Feb;14(3):241-253. doi: 10.2217/fon-2017-0474. Epub 2018 Jan 10.
• [11] Down-regulated paxillin suppresses cell proliferation and invasion by inhibiting M2 macrophage polarization in colon cancer.Biol Chem. 2018 Oct 25;399(11):1285-1295. doi: 10.1515/hsz-2018-0002.
• [12] Identification and functional characterization of paxillin as a target of protein tyrosine phosphatase receptor T.Proc Natl Acad Sci U S A. 2010 Feb 9;107(6):2592-7. doi: 10.1073/pnas.0914884107. Epub 2010 Jan 21.
• [13] FAK, Src and p-Paxillin expression is decreased in liver metastasis of colorectal carcinoma patients.J BUON. 2017 Sep-Oct;22(5):1097-1106.
• [14] Paxillin promotes colorectal tumor invasion and poor patient outcomes via ERK-mediated stabilization of Bcl-2 protein by phosphorylation at Serine 87.Oncotarget. 2015 Apr 20;6(11):8698-708. doi: 10.18632/oncotarget.3537.
• [15] Cytoskeletal Focal Adhesion Proteins Fascin-1 and Paxillin Are Predictors of Malignant Progression and Poor Prognosis in Human Breast Cancer.J Environ Pathol Toxicol Oncol. 2015;34(3):201-12. doi: 10.1615/jenvironpatholtoxicoloncol.2015013663.
• [16] Increased expression of paxillin is found in human oesophageal squamous cell carcinoma: a tissue microarray study.J Int Med Res. 2008 Mar-Apr;36(2):273-8. doi: 10.1177/147323000803600209.
• [17] Fibronectin promotes tyrosine phosphorylation of paxillin and cell invasiveness in the gastric cancer cell line AGS.Tumori. 2009 Nov-Dec;95(6):769-79. doi: 10.1177/030089160909500621.
• [18] Extraribosomal function of metallopanstimulin-1: reducing paxillin in head and neck squamous cell carcinoma and inhibiting tumor growth.Int J Cancer. 2010 Feb 1;126(3):611-9. doi: 10.1002/ijc.24791.
• [19] Focal adhesion kinase (FAK) mediates the induction of pro-oncogenic and fibrogenic phenotypes in hepatitis C virus (HCV)-infected cells.PLoS One. 2012;7(8):e44147. doi: 10.1371/journal.pone.0044147. Epub 2012 Aug 28.
• [20] Paxillin expression and amplification in early lung lesions of high-risk patients, lung adenocarcinoma and metastatic disease.J Clin Pathol. 2011 Jan;64(1):16-24. doi: 10.1136/jcp.2010.075853. Epub 2010 Nov 2.
• [21] Paxillin promotes tumor progression and predicts survival and relapse in oral cavity squamous cell carcinoma by microRNA-218 targeting.Carcinogenesis. 2014 Aug;35(8):1823-9. doi: 10.1093/carcin/bgu102. Epub 2014 Apr 29.
• [22] FAK-Src-paxillin system expression and disease outcome in human neuroblastoma.Pediatr Hematol Oncol. 2017 May;34(4):221-230. doi: 10.1080/08880018.2017.1360969. Epub 2017 Oct 17.
• [23] ETV4 overexpression promotes progression of non-small cell lung cancer by upregulating PXN and MMP1 transcriptionally.Mol Carcinog. 2020 Jan;59(1):73-86. doi: 10.1002/mc.23130. Epub 2019 Oct 31.
• [24] Activation of platelet-activating factor receptor and pleiotropic effects on tyrosine phospho-EGFR/Src/FAK/paxillin in ovarian cancer.Cancer Res. 2008 Jul 15;68(14):5839-48. doi: 10.1158/0008-5472.CAN-07-5771.
• [25] Paxillin regulated genomic networks in prostate cancer.Steroids. 2019 Nov;151:108463. doi: 10.1016/j.steroids.2019.108463. Epub 2019 Jul 22.
• [26] Genetic upregulation of matriptase-2 reduces the aggressiveness of prostate cancer cells in vitro and in vivo and affects FAK and paxillin localisation.J Cell Physiol. 2008 Sep;216(3):780-9. doi: 10.1002/jcp.21460.
• [27] Paxillin: application of immunohistochemistry to the diagnosis of chromophobe renal cell carcinoma and oncocytoma.Appl Immunohistochem Mol Morphol. 2001 Dec;9(4):315-8. doi: 10.1097/00129039-200112000-00005.
• [28] Activation of HGF/c-Met pathway contributes to the reactive oxygen species generation and motility of small cell lung cancer cells.Am J Physiol Lung Cell Mol Physiol. 2007 Jun;292(6):L1488-94. doi: 10.1152/ajplung.00147.2006. Epub 2007 Feb 23.
• [29] Semaphorin 4A enhances lung fibrosis through activation of Akt via PlexinD1 receptor.J Biosci. 2015 Dec;40(5):855-62. doi: 10.1007/s12038-015-9566-9.
• [30] Prognostic value of EZH2, paxillin expression and DNA ploidy of breast adenocarcinoma: correlation to pathologic predictors.J BUON. 2013 Oct-Dec;18(4):879-85.
• [31] Hypoxia- or PDGF-BB-dependent paxillin tyrosine phosphorylation in pulmonary hypertension is reversed by HIF-1 depletion or imatinib treatment.Thromb Haemost. 2014 Dec;112(6):1288-303. doi: 10.1160/TH13-12-1031. Epub 2014 Sep 18.
• [32] Human breast cancer cell metastasis is attenuated by lysyl oxidase inhibitors through down-regulation of focal adhesion kinase and the paxillin-signaling pathway.Breast Cancer Res Treat. 2012 Aug;134(3):989-1004. doi: 10.1007/s10549-012-1986-8. Epub 2012 Mar 21.
• [33] Potential Implication of Paxillin in Cancer Establishment Within the Bone Environment.Anticancer Res. 2017 Aug;37(8):4255-4268. doi: 10.21873/anticanres.11818.
• [34] Adrenomedullin expression in epithelial ovarian cancers and promotes HO8910 cell migration associated with upregulating integrin 51 and phosphorylating FAK and paxillin.J Exp Clin Cancer Res. 2012 Mar 9;31(1):19. doi: 10.1186/1756-9966-31-19.
• [35] Neural Wiskott-Aldrich syndrome protein (nWASP) is implicated in human lung cancer invasion.BMC Cancer. 2017 Mar 28;17(1):224. doi: 10.1186/s12885-017-3219-3.
• [36] A therapeutic trial of human melanomas with combined small interfering RNAs targeting adaptor molecules p130Cas and paxillin activated under expression of ganglioside GD3.Biochim Biophys Acta. 2016 Aug;1860(8):1753-63. doi: 10.1016/j.bbagen.2016.04.005. Epub 2016 Apr 9.
• [37] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [38] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [39] Small ubiquitin-related modifier-1 modification regulates all-trans-retinoic acid-induced differentiation via stabilization of retinoic acid receptor . FEBS J. 2014 Jul;281(13):3032-47. doi: 10.1111/febs.12840. Epub 2014 Jun 2.
• [40] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [41] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] Suberoylanilide hydroxamic acid (SAHA) at subtoxic concentrations increases the adhesivity of human leukemic cells to fibronectin. J Cell Biochem. 2010 Jan 1;109(1):184-95. doi: 10.1002/jcb.22397.
• [45] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [46] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [47] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [48] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [49] Targeted inhibition of SRC kinase signaling attenuates pancreatic tumorigenesis. Mol Cancer Ther. 2010 Aug;9(8):2322-32. doi: 10.1158/1535-7163.MCT-09-1212. Epub 2010 Aug 3.
• [50] Paxillin increases as retinoic acid or vitamin D3 induce HL-60 cell differentiation. In Vitro Cell Dev Biol Anim. 1997 Feb;33(2):84-7. doi: 10.1007/s11626-997-0027-0.
• [51] Terbinafine inhibits endothelial cell migration through suppression of the Rho-mediated pathway. Mol Cancer Ther. 2006 Dec;5(12):3130-8. doi: 10.1158/1535-7163.MCT-06-0457.
• [52] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [53] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [54] The G Protein-Coupled Estrogen Receptor Agonist G-1 Inhibits Nuclear Estrogen Receptor Activity and Stimulates Novel Phosphoproteomic Signatures. Toxicol Sci. 2016 Jun;151(2):434-46. doi: 10.1093/toxsci/kfw057. Epub 2016 Mar 29.
• [55] Comparative mechanisms of PAH toxicity by benzo[a]pyrene and dibenzo[def,p]chrysene in primary human bronchial epithelial cells cultured at air-liquid interface. Toxicol Appl Pharmacol. 2019 Sep 15;379:114644.
• [56] Identification of protein tyrosine phosphatase SHP-2 as a new target of perfluoroalkyl acids in HepG2 cells. Arch Toxicol. 2017 Apr;91(4):1697-1707. doi: 10.1007/s00204-016-1836-2. Epub 2016 Aug 29.
• [57] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [58] Cytotoxic Effects of Environmental Toxins on Human Glial Cells. Neurotox Res. 2017 Feb;31(2):245-258. doi: 10.1007/s12640-016-9678-5. Epub 2016 Oct 29.
• [59] Toxaphene, but not beryllium, induces human neutrophil chemotaxis and apoptosis via reactive oxygen species (ROS): involvement of caspases and ROS in the degradation of cytoskeletal proteins. Clin Immunol. 2002 Jul;104(1):40-8. doi: 10.1006/clim.2002.5226.
• [60] Attenuation of focal adhesion kinase signaling following depletion of agonist-sensitive pools of phosphatidylinositol 4,5-bisphosphate. J Neurochem. 1999 Nov;73(5):1933-44.