Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXP9HOY)

• DOT Name: Density-regulated protein (DENR)
• Synonyms: DRP; Protein DRP1; Smooth muscle cell-associated protein 3; SMAP-3
• Gene Name: DENR
• Related Disease:
  Cerebral infarction
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Autosomal dominant optic atrophy, classic form
  Cardiac failure
  Cardiomyopathy
  Charlevoix-Saguenay spastic ataxia
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  High blood pressure
  Huntington disease
  Hyperglycemia
  Lung cancer
  Lung carcinoma
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Pulmonary arterial hypertension
  Status epilepticus seizure
  Subarachnoid hemorrhage
  Type-1/2 diabetes
  Amyotrophic lateral sclerosis
  Diabetic kidney disease
  Breast cancer
  Breast carcinoma
  Gastric cancer
  Melanoma
  Myocardial infarction
  Nervous system disease
  Neuroblastoma
  Obesity
  Pancreatic cancer
  Pulmonary fibrosis
  Stomach cancer
• UniProt ID: DENR_HUMAN
• PDB ID: 5ONS; 5VYC; 6MS4; 6VPQ; 6VPR
• Pfam ID: PF21023 ; PF01253
• Sequence:
  MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKN
  FPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKI
  PRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQE
  KWPEVDDDSIEDLGEVKK
• Function: May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitmnet of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1.
• Tissue Specificity: Highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cerebral infarction	DISR1WNP	Definitive	Biomarker	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Posttranslational Modification	[6]
Cardiac failure	DISDC067	Strong	Biomarker	[7]
Cardiomyopathy	DISUPZRG	Strong	Altered Expression	[8]
Charlevoix-Saguenay spastic ataxia	DISE8X81	Strong	Biomarker	[9]
Colon cancer	DISVC52G	Strong	Altered Expression	[10]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Posttranslational Modification	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[2]
Glioma	DIS5RPEH	Strong	Biomarker	[14]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
High blood pressure	DISY2OHH	Strong	Biomarker	[17]
Huntington disease	DISQPLA4	Strong	Biomarker	[18]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[1]
Lung cancer	DISCM4YA	Strong	Altered Expression	[19]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[19]
Neoplasm	DISZKGEW	Strong	Altered Expression	[20]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[22]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[13]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Parkinson disease	DISQVHKL	Strong	Biomarker	[23]
Prostate cancer	DISF190Y	Strong	Altered Expression	[24]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[24]
Pulmonary arterial hypertension	DISP8ZX5	Strong	Biomarker	[25]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[26]
Subarachnoid hemorrhage	DISI7I8Y	Strong	Biomarker	[27]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[28]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Genetic Variation	[29]
Diabetic kidney disease	DISJMWEY	moderate	Biomarker	[30]
Breast cancer	DIS7DPX1	Limited	Biomarker	[31]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[31]
Gastric cancer	DISXGOUK	Limited	Biomarker	[32]
Melanoma	DIS1RRCY	Limited	Biomarker	[33]
Myocardial infarction	DIS655KI	Limited	Biomarker	[34]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[35]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[36]
Obesity	DIS47Y1K	Limited	Biomarker	[37]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[38]
Pulmonary fibrosis	DISQKVLA	Limited	Biomarker	[39]
Stomach cancer	DISKIJSX	Limited	Biomarker	[32]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Density-regulated protein (DENR).	[40]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Density-regulated protein (DENR).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Density-regulated protein (DENR).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Density-regulated protein (DENR).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Density-regulated protein (DENR).	[44]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Density-regulated protein (DENR).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Density-regulated protein (DENR).	[46]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Density-regulated protein (DENR).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Density-regulated protein (DENR).	[48]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Density-regulated protein (DENR).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Density-regulated protein (DENR).	[50]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Density-regulated protein (DENR).	[51]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Density-regulated protein (DENR).	[52]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Density-regulated protein (DENR).	[53]

References

• [1] Hyperglycemia abolished Drp-1-mediated mitophagy at the early stage of cerebral ischemia.Eur J Pharmacol. 2019 Jan 15;843:34-44. doi: 10.1016/j.ejphar.2018.11.011. Epub 2018 Nov 14.
• [2] Involvement of Drp1 in hypoxia-induced migration of human glioblastoma U251 cells.Oncol Rep. 2014 Aug;32(2):619-26. doi: 10.3892/or.2014.3235. Epub 2014 Jun 5.
• [3] High expression of density-regulated re-initiation and release factor drives tumourigenesis and affects clinical outcome.Oncol Lett. 2019 Jan;17(1):141-148. doi: 10.3892/ol.2018.9620. Epub 2018 Oct 25.
• [4] Alterations of Transcription of Genes Coding Anti-oxidative and Mitochondria-Related Proteins in Amyloid Toxicity: Relevance to Alzheimer's Disease.Mol Neurobiol. 2020 Mar;57(3):1374-1388. doi: 10.1007/s12035-019-01819-y. Epub 2019 Nov 16.
• [5] Metformin Suppresses Diabetes-Accelerated Atherosclerosis via the Inhibition of Drp1-Mediated Mitochondrial Fission.Diabetes. 2017 Jan;66(1):193-205. doi: 10.2337/db16-0915. Epub 2016 Oct 13.
• [6] Hyperoxia Causes Mitochondrial Fragmentation in Pulmonary Endothelial Cells by Increasing Expression of Pro-Fission Proteins.Arterioscler Thromb Vasc Biol. 2018 Mar;38(3):622-635. doi: 10.1161/ATVBAHA.117.310605. Epub 2018 Feb 1.
• [7] The mechanical effects of CRT promoting autophagy via mitochondrial calcium uniporter down-regulation and mitochondrial dynamics alteration.J Cell Mol Med. 2019 Jun;23(6):3833-3842. doi: 10.1111/jcmm.14227. Epub 2019 Apr 2.
• [8] Irisin ameliorates septic cardiomyopathy via inhibiting DRP1-related mitochondrial fission and normalizing the JNK-LATS2 signaling pathway.Cell Stress Chaperones. 2019 May;24(3):595-608. doi: 10.1007/s12192-019-00992-2. Epub 2019 Apr 16.
• [9] p62/sequestosome-1 knockout delays neurodegeneration induced by Drp1 loss.Neurochem Int. 2018 Jul;117:77-81. doi: 10.1016/j.neuint.2017.05.012. Epub 2017 May 18.
• [10] Downregulation of Drp1, a fission regulator, is associated with human lung and colon cancers.Acta Biochim Biophys Sin (Shanghai). 2018 Feb 1;50(2):209-215. doi: 10.1093/abbs/gmx137.
• [11] Depletion of mitochondrial fission factor DRP1 causes increased apoptosis in human colon cancer cells.Biochem Biophys Res Commun. 2012 Apr 27;421(1):81-5. doi: 10.1016/j.bbrc.2012.03.118. Epub 2012 Apr 2.
• [12] HMGB1 promotes ERK-mediated mitochondrial Drp1 phosphorylation for chemoresistance through RAGE in colorectal cancer.Cell Death Dis. 2018 Sep 26;9(10):1004. doi: 10.1038/s41419-018-1019-6.
• [13] SIK2 promotes reprogramming of glucose metabolism through PI3K/AKT/HIF-1 pathway and Drp1-mediated mitochondrial fission in ovarian cancer.Cancer Lett. 2020 Jan 28;469:89-101. doi: 10.1016/j.canlet.2019.10.029. Epub 2019 Oct 19.
• [14] Silencing Drp1 inhibits glioma cells proliferation and invasion by RHOA/ ROCK1 pathway.Biochem Biophys Res Commun. 2016 Sep 16;478(2):663-8. doi: 10.1016/j.bbrc.2016.08.003. Epub 2016 Aug 3.
• [15] Hippo/Mst1 overexpression induces mitochondrial death in head and neck squamous cell carcinoma via activating -catenin/Drp1 pathway.Cell Stress Chaperones. 2019 Jul;24(4):807-816. doi: 10.1007/s12192-019-01008-9. Epub 2019 May 24.
• [16] Drp1-mediated mitochondrial fission promotes cell proliferation through crosstalk of p53 and NF-B pathways in hepatocellular carcinoma.Oncotarget. 2016 Oct 4;7(40):65001-65011. doi: 10.18632/oncotarget.11339.
• [17] Targeting HSP90 attenuates angiotensin II-induced adventitial remodelling via suppression of mitochondrial fission.Cardiovasc Res. 2020 Apr 1;116(5):1071-1084. doi: 10.1093/cvr/cvz194.
• [18] ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects.Nat Commun. 2019 Mar 26;10(1):1371. doi: 10.1038/s41467-019-09291-x.
• [19] The expression and prognostic significance of Drp1 in lung cancer: A bioinformatics analysis and immunohistochemistry.Medicine (Baltimore). 2019 Nov;98(48):e18228. doi: 10.1097/MD.0000000000018228.
• [20] Cyclooxygenase-2-Mediated Up-Regulation of Mitochondrial Transcription Factor A Mitigates the Radio-Sensitivity of Cancer Cells.Int J Mol Sci. 2019 Mar 11;20(5):1218. doi: 10.3390/ijms20051218.
• [21] The effect of endurance training with crocin consumption on the levels of MFN2 and DRP1 gene expression and glucose and insulin indices in the muscle tissue of diabetic rats.J Food Biochem. 2020 Feb;44(2):e13125. doi: 10.1111/jfbc.13125. Epub 2019 Dec 17.
• [22] Inhibiting crosstalk between MET signaling and mitochondrial dynamics and morphology: a novel therapeutic approach for lung cancer and mesothelioma.Cancer Biol Ther. 2018;19(11):1023-1032. doi: 10.1080/15384047.2018.1472193. Epub 2018 Oct 12.
• [23] Dopamine D1 receptor agonism induces dynamin related protein-1 inhibition to improve mitochondrial biogenesis and dopaminergic neurogenesis in rat model of Parkinson's disease.Behav Brain Res. 2020 Jan 27;378:112304. doi: 10.1016/j.bbr.2019.112304. Epub 2019 Oct 15.
• [24] Androgen-induced expression of DRP1 regulates mitochondrial metabolic reprogramming in prostate cancer.Cancer Lett. 2020 Feb 28;471:72-87. doi: 10.1016/j.canlet.2019.12.017. Epub 2019 Dec 12.
• [25] Glucagon-Like Peptide-1 Receptor Agonist Attenuates Autophagy to Ameliorate Pulmonary Arterial Hypertension through Drp1/NOX- and Atg-5/Atg-7/Beclin-1/LC3 Pathways.Int J Mol Sci. 2019 Jul 12;20(14):3435. doi: 10.3390/ijms20143435.
• [26] p47Phox/CDK5/DRP1-Mediated Mitochondrial Fission Evokes PV Cell Degeneration in the Rat Dentate Gyrus Following Status Epilepticus.Front Cell Neurosci. 2017 Sep 1;11:267. doi: 10.3389/fncel.2017.00267. eCollection 2017.
• [27] Mdivi-1 Alleviates Early Brain Injury After Experimental Subarachnoid Hemorrhage in Rats, Possibly via Inhibition of Drp1-Activated Mitochondrial Fission and Oxidative Stress.Neurochem Res. 2017 May;42(5):1449-1458. doi: 10.1007/s11064-017-2201-4. Epub 2017 Feb 16.
• [28] Redox Regulation of Mitochondrial Fission Protein Drp1 by Protein Disulfide Isomerase Limits Endothelial Senescence.Cell Rep. 2018 Jun 19;23(12):3565-3578. doi: 10.1016/j.celrep.2018.05.054.
• [29] Inhibition of Drp1/Fis1 interaction slows progression of amyotrophic lateral sclerosis.EMBO Mol Med. 2018 Mar;10(3):e8166. doi: 10.15252/emmm.201708166.
• [30] Drp1S600 phosphorylation regulates mitochondrial fission and progression of nephropathy in diabetic mice.J Clin Invest. 2019 May 7;129(7):2807-2823. doi: 10.1172/JCI127277.
• [31] Mst1-Hippo pathway triggers breast cancer apoptosis via inducing mitochondrial fragmentation in a manner dependent on JNK-Drp1 axis.Onco Targets Ther. 2019 Feb 11;12:1147-1159. doi: 10.2147/OTT.S193787. eCollection 2019.
• [32] Indomethacin impairs mitochondrial dynamics by activating the PKC-p38-DRP1 pathway and inducing apoptosis in gastric cancer and normal mucosal cells.J Biol Chem. 2019 May 17;294(20):8238-8258. doi: 10.1074/jbc.RA118.004415. Epub 2019 Apr 2.
• [33] BH3 mimetics induce apoptosis independent of DRP-1 in melanoma.Cell Death Dis. 2018 Sep 5;9(9):907. doi: 10.1038/s41419-018-0932-z.
• [34] A cytoskeletal anchor connects ischemic mitochondrial fission to myocardial senescence.Sci Signal. 2018 Nov 13;11(556):eaav3267. doi: 10.1126/scisignal.aav3267.
• [35] Clinical-genetic features and peculiar muscle histopathology in infantile DNM1L-related mitochondrial epileptic encephalopathy.Hum Mutat. 2019 May;40(5):601-618. doi: 10.1002/humu.23729. Epub 2019 Mar 9.
• [36] Ginkgolide K attenuates neuronal injury after ischemic stroke by inhibiting mitochondrial fission and GSK-3-dependent increases in mitochondrial membrane permeability.Oncotarget. 2017 Jul 4;8(27):44682-44693. doi: 10.18632/oncotarget.17967.
• [37] Roux-en-Y gastric bypass surgery restores insulin-mediated glucose partitioning and mitochondrial dynamics in primary myotubes from severely obese humans.Int J Obes (Lond). 2020 Mar;44(3):684-696. doi: 10.1038/s41366-019-0469-y. Epub 2019 Oct 17.
• [38] DRP1 upregulation promotes pancreatic cancer growth and metastasis through increased aerobic glycolysis.J Gastroenterol Hepatol. 2020 May;35(5):885-895. doi: 10.1111/jgh.14912. Epub 2020 Jan 2.
• [39] miR-30a as Potential Therapeutics by Targeting TET1 through Regulation of Drp-1 Promoter Hydroxymethylation in Idiopathic Pulmonary Fibrosis. Int J Mol Sci. 2017 Mar 15;18(3). pii: E633.
• [40] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [41] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [42] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [46] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [47] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [48] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [49] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [50] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [51] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [52] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [53] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.