General Information of Drug Off-Target (DOT) (ID: OTYAVJWG)

DOT Name Serum amyloid A-2 protein (SAA2)
Synonyms SAA2
Gene Name SAA2
Related Disease
Autoimmune disease ( )
Myelodysplastic syndrome ( )
Adenocarcinoma ( )
Allergic asthma ( )
Alzheimer disease ( )
Alzheimer disease 3 ( )
Arteriosclerosis ( )
Astrocytoma ( )
Atherosclerosis ( )
Atopic dermatitis ( )
Colitis ( )
Colon cancer ( )
Colon carcinoma ( )
Cystic fibrosis ( )
Diabetic kidney disease ( )
Hepatocellular carcinoma ( )
Inflammatory bowel disease ( )
Liver cirrhosis ( )
Myocardial ischemia ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Obesity ( )
Osteoarthritis ( )
Pancytopenia ( )
Polyp ( )
Psoriasis ( )
Rheumatoid arthritis ( )
Sarcoidosis ( )
Small-cell lung cancer ( )
T-cell lymphoma ( )
Triple negative breast cancer ( )
Advanced cancer ( )
Bacterial infection ( )
Colorectal carcinoma ( )
Coronary atherosclerosis ( )
Mental disorder ( )
Neuroblastoma ( )
Psychotic disorder ( )
Familial Mediterranean fever ( )
Pneumonia ( )
Arthritis ( )
Asthma ( )
Autism spectrum disorder ( )
Cardiovascular disease ( )
Glaucoma/ocular hypertension ( )
High blood pressure ( )
Lung cancer ( )
Lung carcinoma ( )
Non-insulin dependent diabetes ( )
UniProt ID
SAA2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00277
Sequence
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
DAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPE
KY
Function Major acute phase reactant.
Tissue Specificity Expressed by the liver; secreted in plasma.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoimmune disease DISORMTM Definitive Biomarker [1]
Myelodysplastic syndrome DISYHNUI Definitive Biomarker [1]
Adenocarcinoma DIS3IHTY Strong Altered Expression [2]
Allergic asthma DISHF0H3 Strong Biomarker [3]
Alzheimer disease DISF8S70 Strong Altered Expression [4]
Alzheimer disease 3 DISVT69G Strong Altered Expression [4]
Arteriosclerosis DISK5QGC Strong Biomarker [5]
Astrocytoma DISL3V18 Strong Altered Expression [6]
Atherosclerosis DISMN9J3 Strong Biomarker [5]
Atopic dermatitis DISTCP41 Strong Altered Expression [4]
Colitis DISAF7DD Strong Altered Expression [2]
Colon cancer DISVC52G Strong Biomarker [7]
Colon carcinoma DISJYKUO Strong Biomarker [7]
Cystic fibrosis DIS2OK1Q Strong Biomarker [8]
Diabetic kidney disease DISJMWEY Strong Biomarker [9]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [10]
Inflammatory bowel disease DISGN23E Strong Biomarker [7]
Liver cirrhosis DIS4G1GX Strong Biomarker [10]
Myocardial ischemia DISFTVXF Strong Genetic Variation [11]
Neoplasm DISZKGEW Strong Altered Expression [12]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [13]
Obesity DIS47Y1K Strong Biomarker [14]
Osteoarthritis DIS05URM Strong Biomarker [15]
Pancytopenia DISVKEHV Strong Genetic Variation [16]
Polyp DISRSLYF Strong Altered Expression [17]
Psoriasis DIS59VMN Strong Altered Expression [4]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [18]
Sarcoidosis DISE5B8Z Strong Biomarker [19]
Small-cell lung cancer DISK3LZD Strong Biomarker [13]
T-cell lymphoma DISSXRTQ Strong Biomarker [20]
Triple negative breast cancer DISAMG6N Strong Biomarker [21]
Advanced cancer DISAT1Z9 moderate Genetic Variation [16]
Bacterial infection DIS5QJ9S moderate Genetic Variation [22]
Colorectal carcinoma DIS5PYL0 moderate Altered Expression [23]
Coronary atherosclerosis DISKNDYU moderate Biomarker [24]
Mental disorder DIS3J5R8 moderate Genetic Variation [25]
Neuroblastoma DISVZBI4 moderate Altered Expression [26]
Psychotic disorder DIS4UQOT moderate Genetic Variation [25]
Familial Mediterranean fever DISVP5WP Disputed Genetic Variation [27]
Pneumonia DIS8EF3M Disputed Biomarker [28]
Arthritis DIST1YEL Limited Altered Expression [18]
Asthma DISW9QNS Limited Genetic Variation [29]
Autism spectrum disorder DISXK8NV Limited Genetic Variation [30]
Cardiovascular disease DIS2IQDX Limited Genetic Variation [31]
Glaucoma/ocular hypertension DISLBXBY Limited Altered Expression [32]
High blood pressure DISY2OHH Limited Biomarker [33]
Lung cancer DISCM4YA Limited Biomarker [34]
Lung carcinoma DISTR26C Limited Biomarker [34]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 49 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Serum amyloid A-2 protein (SAA2). [36]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Serum amyloid A-2 protein (SAA2). [37]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Serum amyloid A-2 protein (SAA2). [38]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Serum amyloid A-2 protein (SAA2). [39]
Testosterone DM7HUNW Approved Testosterone increases the expression of Serum amyloid A-2 protein (SAA2). [39]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Serum amyloid A-2 protein (SAA2). [40]
Progesterone DMUY35B Approved Progesterone increases the expression of Serum amyloid A-2 protein (SAA2). [41]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Serum amyloid A-2 protein (SAA2). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 T-cell receptor Vbeta CDR3 oligoclonality frequently occurs in childhood refractory cytopenia (MDS-RC) and severe aplastic anemia.Leukemia. 2008 Jun;22(6):1170-4. doi: 10.1038/leu.2008.23. Epub 2008 Mar 6.
2 Platelets contribute to the initiation of colitis-associated cancer by promoting immunosuppression.J Thromb Haemost. 2018 Apr;16(4):762-777. doi: 10.1111/jth.13959. Epub 2018 Mar 2.
3 Short- and long-term real-world effectiveness of omalizumab in severe allergic asthma: systematic review of 42 studies published 2008-2018.Expert Rev Clin Immunol. 2019 May;15(5):553-569. doi: 10.1080/1744666X.2019.1574571. Epub 2019 Feb 14.
4 Interleukin-17A-induced production of acute serum amyloid A by keratinocytes contributes to psoriasis pathogenesis.PLoS One. 2017 Jul 14;12(7):e0181486. doi: 10.1371/journal.pone.0181486. eCollection 2017.
5 Editorial: dose-dependent ZnO particle-induced acute phase response in humans warrants re-evaluation of occupational exposure limits for metal oxides.Part Fibre Toxicol. 2018 Feb 12;15(1):7. doi: 10.1186/s12989-018-0247-3.
6 Serum amyloid A1 is upregulated in human glioblastoma.J Neurooncol. 2017 May;132(3):383-391. doi: 10.1007/s11060-017-2386-z. Epub 2017 Mar 11.
7 Stability of the N-Terminal Helix and Its Role in Amyloid Formation of Serum Amyloid A.ACS Omega. 2018 Nov 30;3(11):16184-16190. doi: 10.1021/acsomega.8b02377. Epub 2018 Nov 29.
8 Acute phase reactant serum amyloid A in inflammation and other diseases.Adv Clin Chem. 2019;90:25-80. doi: 10.1016/bs.acc.2019.01.002. Epub 2019 Mar 5.
9 Serum amyloid A and inflammation in diabetic kidney disease and podocytes.Lab Invest. 2015 Mar;95(3):250-62. doi: 10.1038/labinvest.2014.163. Epub 2014 Dec 22.
10 Serum Amyloid A-Positive Hepatocellular Neoplasm: A New Type of Tumor Arising in Patients with Advanced Alcoholic Disease.Dig Dis. 2015 Sep;33(5):648-54. doi: 10.1159/000438474. Epub 2015 Sep 23.
11 Risk Factors for Restenosis After Stenting or Angioplasty of Vertebral Artery Origin : Results of Short-term and Long-term Follow-up.Clin Neuroradiol. 2020 Jun;30(2):355-362. doi: 10.1007/s00062-019-00768-2. Epub 2019 Feb 19.
12 Serum amyloid A expression in the breast cancer tissue is associated with poor prognosis.Oncotarget. 2016 Jun 14;7(24):35843-35852. doi: 10.18632/oncotarget.8561.
13 Identification of serum proteins and multivariate models for diagnosis and therapeutic monitoring of lung cancer.Oncotarget. 2017 Mar 21;8(12):18901-18913. doi: 10.18632/oncotarget.14782.
14 Serum amyloid A attenuates cellular insulin sensitivity by increasing JNK activity in 3T3-L1 adipocytes.J Endocrinol Invest. 2009 Jul;32(7):568-75. doi: 10.1007/BF03346510. Epub 2009 Mar 26.
15 Apolipoprotein-A1 as a damage-associated molecular patterns protein in osteoarthritis: ex vivo and in vitro pro-inflammatory properties.PLoS One. 2015 Apr 7;10(4):e0122904. doi: 10.1371/journal.pone.0122904. eCollection 2015.
16 Development and current use of in hematopoietic stem cell transplantation in children and adolescents in Poland: Report of the Polish pediatric study group for hematopoietic stem cell transplantation of the Polish society for pediatric oncology and hematology.Transfus Apher Sci. 2018 Jun;57(3):316-322. doi: 10.1016/j.transci.2018.05.012. Epub 2018 May 16.
17 Increased serum amyloid A in nasal polyps is associated with systemic corticosteroid insensitivity in patients with chronic rhinosinusitis with nasal polyps: a pilot study.Eur Arch Otorhinolaryngol. 2018 Feb;275(2):401-408. doi: 10.1007/s00405-017-4809-z. Epub 2017 Nov 25.
18 Local expression of the serum amyloid A and formyl peptide receptor-like 1 genes in synovial tissue is associated with matrix metalloproteinase production in patients with inflammatory arthritis.Arthritis Rheum. 2004 Jun;50(6):1788-99. doi: 10.1002/art.20301.
19 The role of serum amyloid A staining of granulomatous tissues for the diagnosis of sarcoidosis.Respir Med. 2017 May;126:1-8. doi: 10.1016/j.rmed.2017.03.009. Epub 2017 Mar 8.
20 Suppressor mutations within the core binding factor (CBF/AML1) binding site of a T-cell lymphomagenic retrovirus.J Virol. 1999 Mar;73(3):2143-52. doi: 10.1128/JVI.73.3.2143-2152.1999.
21 Serum amyloid A predisposes inflammatory tumor microenvironment in triple negative breast cancer.Oncotarget. 2019 Jan 11;10(4):511-526. doi: 10.18632/oncotarget.26566. eCollection 2019 Jan 11.
22 Organization and biology of the porcine serum amyloid A (SAA) gene cluster: isoform specific responses to bacterial infection.PLoS One. 2013 Oct 11;8(10):e76695. doi: 10.1371/journal.pone.0076695. eCollection 2013.
23 Hepatocytes direct the formation of a pro-metastatic niche in the liver.Nature. 2019 Mar;567(7747):249-252. doi: 10.1038/s41586-019-1004-y. Epub 2019 Mar 6.
24 Salvianolic acid A targeting the transgelin-actin complex to enhance vasoconstriction.EBioMedicine. 2018 Nov;37:246-258. doi: 10.1016/j.ebiom.2018.10.041. Epub 2018 Oct 23.
25 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.Schizophr Res. 2010 Dec;124(1-3):192-9. doi: 10.1016/j.schres.2010.09.002.
26 Protein chip array profiling analysis of sera from neuroblastoma patients.Cancer Lett. 2005 Oct 18;228(1-2):91-6. doi: 10.1016/j.canlet.2004.12.053.
27 MEFV and SAA1 genotype associations with clinical features of familial Mediterranean fever and amyloidosis in Armenia.Clin Exp Rheumatol. 2016 Sep-Oct;34(6 Suppl 102):72-76. Epub 2016 Oct 25.
28 Biomarkers predictive value for early diagnosis of Stroke-Associated Pneumonia.Ann Clin Transl Neurol. 2019 Sep;6(9):1882-1887. doi: 10.1002/acn3.50849. Epub 2019 Jul 31.
29 ALX receptor ligands define a biochemical endotype for severe asthma.JCI Insight. 2017 Jul 20;2(14):e93534. doi: 10.1172/jci.insight.93534. eCollection 2017 Jul 20.
30 Elevated protein concentrations in newborn blood and the risks of autism spectrum disorder, and of social impairment, at age 10 years among infants born before the 28th week of gestation.Transl Psychiatry. 2018 Jun 8;8(1):115. doi: 10.1038/s41398-018-0156-0.
31 Serum amyloid A levels are associated with polymorphic variants in the serum amyloid A 1 and 2 genes.Ir J Med Sci. 2019 Nov;188(4):1175-1183. doi: 10.1007/s11845-019-01996-8. Epub 2019 Mar 9.
32 Increased expression of serum amyloid A in glaucoma and its effect on intraocular pressure.Invest Ophthalmol Vis Sci. 2008 May;49(5):1916-23. doi: 10.1167/iovs.07-1104. Epub 2008 Jan 25.
33 Opportunities to Leverage Telehealth Approaches Along the Hypertension Control Cascade in Sub-Saharan Africa.Curr Hypertens Rep. 2019 Aug 26;21(10):75. doi: 10.1007/s11906-019-0983-2.
34 Ubiquitination of tumor suppressor PML regulates prometastatic and immunosuppressive tumor microenvironment.J Clin Invest. 2017 Aug 1;127(8):2982-2997. doi: 10.1172/JCI89957. Epub 2017 Jul 10.
35 Association of SelS mRNA expression in omental adipose tissue with Homa-IR and serum amyloid A in patients with type 2 diabetes mellitus.Chin Med J (Engl). 2008 Jul 5;121(13):1165-8.
36 Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
37 Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
38 Gene expression data from acetaminophen-induced toxicity in human hepatic in vitro systems and clinical liver samples. Data Brief. 2016 Mar 26;7:1052-1057. doi: 10.1016/j.dib.2016.03.069. eCollection 2016 Jun.
39 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
40 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
41 Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
42 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.