Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ3JX8Q)

• DOT Name: Myb-related protein B (MYBL2)
• Synonyms: B-Myb; Myb-like protein 2
• Gene Name: MYBL2
• Related Disease:
  Advanced cancer
  Acute myelogenous leukaemia
  Acute myocardial infarction
  Adult glioblastoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Cervical Intraepithelial neoplasia
  Colorectal neoplasm
  Endometrial cancer
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Her2-receptor negative breast cancer
  Herpes simplex infection
  leukaemia
  Leukemia
  Lung adenocarcinoma
  Metastatic malignant neoplasm
  Mycosis fungoides
  Myelodysplastic syndrome
  Myocardial infarction
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Precancerous condition
  Retinoblastoma
  Sezary syndrome
  Stomach cancer
  Bladder cancer
  Castration-resistant prostate carcinoma
  Scleroderma
  Small lymphocytic lymphoma
  Systemic sclerosis
  Endometrial carcinoma
  Gallbladder cancer
  Gallbladder carcinoma
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Neuroblastoma
  Pancreatic ductal carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: MYBB_HUMAN
• PDB ID: 6C48
• Pfam ID: PF09316 ; PF13921 ; PF00249
• Sequence:
  MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASH
  FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
  CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
  KRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEEN
  SEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
  IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQASHQQQVLPPRQ
  PSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL
  SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCS
  QKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPH
  LEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
  TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMS
  SAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
• Function: Transcription factor involved in the regulation of cell survival, proliferation, and differentiation. Transactivates the expression of the CLU gene.
• KEGG Pathway: Cellular senescence (hsa04218)
• Reactome Pathway:
  Polo-like kinase mediated events (R-HSA-156711)
  TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation (R-HSA-8869496)
  Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1 (R-HSA-1362300)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[2]
Acute myocardial infarction	DISE3HTG	Strong	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Cervical cancer	DISFSHPF	Strong	Biomarker	[7]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[7]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Biomarker	[8]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[9]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[11]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[12]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[4]
Glioma	DIS5RPEH	Strong	Altered Expression	[4]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[13]
Her2-receptor negative breast cancer	DISS605N	Strong	Biomarker	[14]
Herpes simplex infection	DISL1SAV	Strong	Altered Expression	[15]
leukaemia	DISS7D1V	Strong	Biomarker	[16]
Leukemia	DISNAKFL	Strong	Biomarker	[16]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[18]
Mycosis fungoides	DIS62RB8	Strong	Biomarker	[19]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[20]
Myocardial infarction	DIS655KI	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Altered Expression	[12]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[1]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[1]
Precancerous condition	DISV06FL	Strong	Altered Expression	[22]
Retinoblastoma	DISVPNPB	Strong	Altered Expression	[23]
Sezary syndrome	DISFMTC7	Strong	Genetic Variation	[19]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[12]
Bladder cancer	DISUHNM0	moderate	Altered Expression	[24]
Castration-resistant prostate carcinoma	DISVGAE6	moderate	Biomarker	[25]
Scleroderma	DISVQ342	moderate	Altered Expression	[26]
Small lymphocytic lymphoma	DIS30POX	moderate	Altered Expression	[27]
Systemic sclerosis	DISF44L6	moderate	Altered Expression	[26]
Endometrial carcinoma	DISXR5CY	Limited	Biomarker	[28]
Gallbladder cancer	DISXJUAF	Limited	Biomarker	[29]
Gallbladder carcinoma	DISD6ACL	Limited	Biomarker	[29]
Lung cancer	DISCM4YA	Limited	Altered Expression	[30]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[30]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[31]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[32]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[31]
Urinary bladder cancer	DISDV4T7	Limited	Altered Expression	[24]
Urinary bladder neoplasm	DIS7HACE	Limited	Altered Expression	[24]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Myb-related protein B (MYBL2).	[33]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Myb-related protein B (MYBL2).	[57]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Myb-related protein B (MYBL2).	[59]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Myb-related protein B (MYBL2).	[59]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Myb-related protein B (MYBL2).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Myb-related protein B (MYBL2).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Myb-related protein B (MYBL2).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Myb-related protein B (MYBL2).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Myb-related protein B (MYBL2).	[38]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Myb-related protein B (MYBL2).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Myb-related protein B (MYBL2).	[35]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Myb-related protein B (MYBL2).	[40]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Myb-related protein B (MYBL2).	[41]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Myb-related protein B (MYBL2).	[42]
Marinol	DM70IK5	Approved	Marinol increases the expression of Myb-related protein B (MYBL2).	[43]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Myb-related protein B (MYBL2).	[44]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Myb-related protein B (MYBL2).	[45]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Myb-related protein B (MYBL2).	[46]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Myb-related protein B (MYBL2).	[47]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Myb-related protein B (MYBL2).	[48]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Myb-related protein B (MYBL2).	[49]
Exemestane	DM9HPW3	Approved	Exemestane increases the expression of Myb-related protein B (MYBL2).	[50]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Myb-related protein B (MYBL2).	[50]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Myb-related protein B (MYBL2).	[51]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of Myb-related protein B (MYBL2).	[52]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Myb-related protein B (MYBL2).	[53]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Myb-related protein B (MYBL2).	[54]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Myb-related protein B (MYBL2).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Myb-related protein B (MYBL2).	[56]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Myb-related protein B (MYBL2).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Myb-related protein B (MYBL2).	[60]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Myb-related protein B (MYBL2).	[51]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Myb-related protein B (MYBL2).	[61]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Myb-related protein B (MYBL2).	[62]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Myb-related protein B (MYBL2).	[39]

References

• [1] The cell cycle regulatory DREAM complex is disrupted by high expression of oncogenic B-Myb.Oncogene. 2019 Feb;38(7):1080-1092. doi: 10.1038/s41388-018-0490-y. Epub 2018 Sep 11.
• [2] circMYBL2, a circRNA from MYBL2, regulates FLT3 translation by recruiting PTBP1 to promote FLT3-ITD AML progression.Blood. 2019 Oct 31;134(18):1533-1546. doi: 10.1182/blood.2019000802.
• [3] Identifying key genes associated with acute myocardial infarction.Medicine (Baltimore). 2017 Oct;96(42):e7741. doi: 10.1097/MD.0000000000007741.
• [4] Akt/FoxM1 signaling pathway-mediated upregulation of MYBL2 promotes progression of human glioma.J Exp Clin Cancer Res. 2017 Aug 7;36(1):105. doi: 10.1186/s13046-017-0573-6.
• [5] MYBL2 Is Targeted by miR-143-3p and Regulates Breast Cancer Cell Proliferation and Apoptosis.Oncol Res. 2018 Jul 5;26(6):913-922. doi: 10.3727/096504017X15135941182107. Epub 2017 Dec 21.
• [6] In vitro and in vivo analysis of B-Myb in basal-like breast cancer.Oncogene. 2009 Feb 5;28(5):742-51. doi: 10.1038/onc.2008.430. Epub 2008 Dec 1.
• [7] circ-MYBL2 Serves As A Sponge For miR-361-3p Promoting Cervical Cancer Cells Proliferation And Invasion.Onco Targets Ther. 2019 Nov 20;12:9957-9964. doi: 10.2147/OTT.S218976. eCollection 2019.
• [8] MYBL2 (B-MYB) in cervical cancer: putative biomarker.Int J Gynecol Cancer. 2011 Feb;21(2):206-12. doi: 10.1097/IGC.0b013e318205759f.
• [9] Detection of colorectal cancer cells from feces using quantitative real-time RT-PCR for colorectal cancer diagnosis.Cancer Sci. 2008 Oct;99(10):1977-83. doi: 10.1111/j.1349-7006.2008.00954.x.
• [10] Estrogen receptor transcript variants associate with oncogene expression in endometrial cancer.Int J Mol Med. 2012 Jun;29(6):1127-36. doi: 10.3892/ijmm.2012.929. Epub 2012 Feb 28.
• [11] Prognostic implications and oncogenic roles of MYBL2 protein expression in esophageal squamous-cell carcinoma.Onco Targets Ther. 2019 Mar 8;12:1917-1927. doi: 10.2147/OTT.S190145. eCollection 2019.
• [12] Prognostic implications of MYBL2 in resected Chinese gastric adenocarcinoma patients.Onco Targets Ther. 2019 Feb 11;12:1129-1135. doi: 10.2147/OTT.S188820. eCollection 2019.
• [13] YAP-dependent induction of UHMK1 supports nuclear enrichment of the oncogene MYBL2 and proliferation in liver cancer cells.Oncogene. 2019 Jul;38(27):5541-5550. doi: 10.1038/s41388-019-0801-y. Epub 2019 Apr 1.
• [14] Identification of key candidate genes, pathways and related prognostic values in ER-negative/HER2-negative breast cancer by bioinformatics analysis.J BUON. 2018 Jul-Aug;23(4):891-901.
• [15] Targeted oncolytic herpes simplex virus type 1 eradicates experimental pancreatic tumors.Hum Gene Ther. 2015 Feb;26(2):104-13. doi: 10.1089/hum.2014.072. Epub 2015 Jan 19.
• [16] Tax oncoprotein trans-represses endogenous B-myb promoter activity in human T cells.AIDS Res Hum Retroviruses. 2000 Nov 1;16(16):1629-32. doi: 10.1089/08892220050193065.
• [17] LncRNA LOXL1-AS1 regulates the tumorigenesis and development of lung adenocarcinoma through sponging miR-423-5p and targeting MYBL2.Cancer Med. 2020 Jan;9(2):689-699. doi: 10.1002/cam4.2641. Epub 2019 Nov 23.
• [18] B-myb is a gene implicated in cell cycle and proliferation of breast cancer.Int J Clin Exp Pathol. 2014 Aug 15;7(9):5819-27. eCollection 2014.
• [19] Amplification and overexpression of JUNB is associated with primary cutaneous T-cell lymphomas.Blood. 2003 Feb 15;101(4):1513-9. doi: 10.1182/blood-2002-08-2434. Epub 2002 Oct 3.
• [20] MYBL2 Supports DNA Double Strand Break Repair in Hematopoietic Stem Cells.Cancer Res. 2018 Oct 15;78(20):5767-5779. doi: 10.1158/0008-5472.CAN-18-0273. Epub 2018 Aug 6.
• [21] MYBL2 protects against H9c2 injury induced by hypoxia via AKT and NFB pathways.Mol Med Rep. 2018 Mar;17(3):4832-4838. doi: 10.3892/mmr.2018.8387. Epub 2018 Jan 8.
• [22] Mybl2 expression is under genetic control and contributes to determine a hepatocellular carcinoma susceptible phenotype.J Hepatol. 2011 Jul;55(1):111-9. doi: 10.1016/j.jhep.2010.10.031. Epub 2010 Dec 7.
• [23] Human papillomavirus E7 repression in cervical carcinoma cells initiates a transcriptional cascade driven by the retinoblastoma family, resulting in senescence.J Virol. 2007 Mar;81(5):2102-16. doi: 10.1128/JVI.02348-06. Epub 2006 Dec 20.
• [24] Circ_0006332 promotes growth and progression of bladder cancer by modulating MYBL2 expression via miR-143.Aging (Albany NY). 2019 Nov 22;11(22):10626-10643. doi: 10.18632/aging.102481. Epub 2019 Nov 22.
• [25] Definition of a FoxA1 Cistrome that is crucial for G1 to S-phase cell-cycle transit in castration-resistant prostate cancer.Cancer Res. 2011 Nov 1;71(21):6738-6748. doi: 10.1158/0008-5472.CAN-11-1882. Epub 2011 Sep 7.
• [26] B-Myb acts as a repressor of human COL1A1 collagen gene expression by interacting with Sp1 and CBF factors in scleroderma fibroblasts.Biochem J. 2004 Mar 1;378(Pt 2):609-16. doi: 10.1042/BJ20031110.
• [27] miR-34a induces the downregulation of both E2F1 and B-Myb oncogenes in leukemic cells.Clin Cancer Res. 2011 May 1;17(9):2712-24. doi: 10.1158/1078-0432.CCR-10-3244. Epub 2011 Mar 2.
• [28] ATAD2 overexpression links to enrichment of B-MYB-translational signatures and development of aggressive endometrial carcinoma.Oncotarget. 2015 Sep 29;6(29):28440-52. doi: 10.18632/oncotarget.4955.
• [29] MYBL2 is a Potential Prognostic Marker that Promotes Cell Proliferation in Gallbladder Cancer.Cell Physiol Biochem. 2017;41(5):2117-2131. doi: 10.1159/000475454. Epub 2017 Apr 17.
• [30] B-Myb Is Up-Regulated and Promotes Cell Growth and Motility in Non-Small Cell Lung Cancer.Int J Mol Sci. 2017 May 27;18(6):860. doi: 10.3390/ijms18060860.
• [31] Clinicopathologic features and prognostic implications of MYBL2 protein expression in pancreatic ductal adenocarcinoma.Pathol Res Pract. 2017 Aug;213(8):964-968. doi: 10.1016/j.prp.2017.04.024. Epub 2017 May 4.
• [32] A chemical screen identifies the chemotherapeutic drug topotecan as a specific inhibitor of the B-MYB/MYCN axis in neuroblastoma.Oncotarget. 2012 May;3(5):535-45. doi: 10.18632/oncotarget.498.
• [33] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [34] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [35] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [36] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [37] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [38] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [39] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [40] Induction of apoptosis in U937 human leukemia cells by suberoylanilide hydroxamic acid (SAHA) proceeds through pathways that are regulated by Bcl-2/Bcl-XL, c-Jun, and p21CIP1, but independent of p53. Oncogene. 1999 Nov 25;18(50):7016-25. doi: 10.1038/sj.onc.1203176.
• [41] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [42] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [43] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [44] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [45] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [46] Troglitazone suppresses cell growth of KU812 cells independently of PPARgamma. Eur J Pharmacol. 2002 Feb 1;436(1-2):7-13. doi: 10.1016/s0014-2999(01)01577-1.
• [47] Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
• [48] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [49] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [50] Effects of aromatase inhibitors on human osteoblast and osteoblast-like cells: a possible androgenic bone protective effects induced by exemestane. Bone. 2007 Apr;40(4):876-87. doi: 10.1016/j.bone.2006.11.029. Epub 2006 Dec 28.
• [51] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [52] Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
• [53] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [54] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [55] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [56] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [57] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [58] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [59] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [60] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [61] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [62] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.