Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1K0L0D)

• DOT Name: Nucleolar protein 3 (NOL3)
• Synonyms: Apoptosis repressor with CARD; Muscle-enriched cytoplasmic protein; Myp; Nucleolar protein of 30 kDa; Nop30
• Gene Name: NOL3
• Related Disease:
  Cognitive impairment
  Neural tube defect
  Primary sclerosing cholangitis
  Acute leukaemia
  Acute myelogenous leukaemia
  Alzheimer disease
  B-cell lymphoma
  B-cell neoplasm
  Breast cancer
  Breast carcinoma
  Burkitt lymphoma
  Classic Hodgkin lymphoma
  Clear cell renal carcinoma
  Cocaine addiction
  Colonic neoplasm
  Depression
  Dilated cardiomyopathy
  Endometrial cancer
  Endometrial carcinoma
  Gastric cancer
  Hepatocellular carcinoma
  Hypertrophic cardiomyopathy
  Malignant glioma
  Nasopharyngeal carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Parkinson disease
  Post-traumatic stress disorder
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Stomach cancer
  T-cell lymphoma
  Triple negative breast cancer
  Wiskott-Aldrich syndrome
  Mitochondrial disease
  Neuralgia
  Myoclonus, familial
  Acute lymphocytic leukaemia
  Lymphoid leukemia
  Adrenoleukodystrophy
  Asthma
  Colorectal carcinoma
  Inflammatory bowel disease
  Leukemia
  Lymphoma
  Myoclonus, familial, 1
  Neuroblastoma
  Non-insulin dependent diabetes
• UniProt ID: NOL3_HUMAN
• PDB ID: 4UZ0
• Pfam ID: PF00619
• Sequence:
  MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
  LLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGS
  GTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAE
  AEPEPELEPEPDPEPEPDFEERDESEDS
• Function: [Isoform 1]: May be involved in RNA splicing; [Isoform 2]: Functions as an apoptosis repressor that blocks multiple modes of cell death. Inhibits extrinsic apoptotic pathways through two different ways. Firstly by interacting with FAS and FADD upon FAS activation blocking death-inducing signaling complex (DISC) assembly. Secondly by interacting with CASP8 in a mitochondria localization- and phosphorylation-dependent manner, limiting the amount of soluble CASP8 available for DISC-mediated activation. Inhibits intrinsic apoptotic pathway in response to a wide range of stresses, through its interaction with BAX resulting in BAX inactivation, preventing mitochondrial dysfunction and release of pro-apoptotic factors. Inhibits calcium-mediated cell death by functioning as a cytosolic calcium buffer, dissociating its interaction with CASP8 and maintaining calcium homeostasis. Negatively regulates oxidative stress-induced apoptosis by phosphorylation-dependent suppression of the mitochondria-mediated intrinsic pathway, by blocking CASP2 activation and BAX translocation. Negatively regulates hypoxia-induced apoptosis in part by inhibiting the release of cytochrome c from mitochondria in a caspase-independent manner. Also inhibits TNF-induced necrosis by preventing TNF-signaling pathway through TNFRSF1A interaction abrogating the recruitment of RIPK1 to complex I. Finally through its role as apoptosis repressor, promotes vascular remodeling through inhibition of apoptosis and stimulation of proliferation, in response to hypoxia. Inhibits too myoblast differentiation through caspase inhibition.
• Tissue Specificity: Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cognitive impairment	DISH2ERD	Definitive	Biomarker	[1]
Neural tube defect	DIS5J95E	Definitive	Altered Expression	[2]
Primary sclerosing cholangitis	DISTH5WJ	Definitive	Biomarker	[3]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[7]
B-cell neoplasm	DISVY326	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Burkitt lymphoma	DIS9D5XU	Strong	Biomarker	[10]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[11]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[12]
Cocaine addiction	DISHTRXG	Strong	Altered Expression	[13]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[14]
Depression	DIS3XJ69	Strong	Biomarker	[15]
Dilated cardiomyopathy	DISX608J	Strong	Genetic Variation	[16]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[17]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[17]
Gastric cancer	DISXGOUK	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[19]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[16]
Malignant glioma	DISFXKOV	Strong	Biomarker	[20]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[23]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[24]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[25]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[26]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[12]
Stomach cancer	DISKIJSX	Strong	Biomarker	[18]
T-cell lymphoma	DISSXRTQ	Strong	Biomarker	[8]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[27]
Wiskott-Aldrich syndrome	DISATMDB	Strong	Genetic Variation	[28]
Mitochondrial disease	DISKAHA3	moderate	Therapeutic	[29]
Neuralgia	DISWO58J	moderate	Biomarker	[30]
Myoclonus, familial	DISAQA19	Supportive	Autosomal dominant	[31]
Acute lymphocytic leukaemia	DISPX75S	Disputed	Biomarker	[32]
Lymphoid leukemia	DIS65TYQ	Disputed	Biomarker	[32]
Adrenoleukodystrophy	DISTUD1F	Limited	Altered Expression	[33]
Asthma	DISW9QNS	Limited	Biomarker	[34]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[35]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[36]
Leukemia	DISNAKFL	Limited	Biomarker	[37]
Lymphoma	DISN6V4S	Limited	Biomarker	[37]
Myoclonus, familial, 1	DIS04NMC	Limited	Autosomal dominant	[38]
Neuroblastoma	DISVZBI4	Limited	Altered Expression	[39]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[40]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Nucleolar protein 3 (NOL3) decreases the response to substance of Arsenic trioxide.	[59]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nucleolar protein 3 (NOL3).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nucleolar protein 3 (NOL3).	[52]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Nucleolar protein 3 (NOL3).	[56]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Nucleolar protein 3 (NOL3).	[57]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Nucleolar protein 3 (NOL3).	[56]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nucleolar protein 3 (NOL3).	[42]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Nucleolar protein 3 (NOL3).	[43]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Nucleolar protein 3 (NOL3).	[44]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Nucleolar protein 3 (NOL3).	[45]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nucleolar protein 3 (NOL3).	[46]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Nucleolar protein 3 (NOL3).	[47]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Nucleolar protein 3 (NOL3).	[48]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Nucleolar protein 3 (NOL3).	[49]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Nucleolar protein 3 (NOL3).	[50]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Nucleolar protein 3 (NOL3).	[51]
AMEP	DMFELMQ	Phase 1	AMEP increases the expression of Nucleolar protein 3 (NOL3).	[53]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 increases the expression of Nucleolar protein 3 (NOL3).	[54]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Nucleolar protein 3 (NOL3).	[55]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Nucleolar protein 3 (NOL3).	[58]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Nucleolar protein 3 (NOL3).	[53]

References

• [1] Intra-nasal dopamine alleviates cognitive deficits in tgDISC1 rats which overexpress the human DISC1 gene.Neurobiol Learn Mem. 2017 Dec;146:12-20. doi: 10.1016/j.nlm.2017.10.015. Epub 2017 Oct 28.
• [2] Regulation of the expression of tumor necrosis factorrelated genes by abnormal histone H3K27 acetylation: Implications for neural tube defects.Mol Med Rep. 2018 Jun;17(6):8031-8038. doi: 10.3892/mmr.2018.8900. Epub 2018 Apr 19.
• [3] Phenotyping and auto-antibody production by liver-infiltrating B cells in primary sclerosing cholangitis and primary biliary cholangitis.J Autoimmun. 2017 Feb;77:45-54. doi: 10.1016/j.jaut.2016.10.003. Epub 2016 Oct 24.
• [4] Combined use of WT1 and flow cytometry monitoring can promote sensitivity of predicting relapse after allogeneic HSCT without affecting specificity.Ann Hematol. 2013 Aug;92(8):1111-9. doi: 10.1007/s00277-013-1733-1. Epub 2013 May 17.
• [5] Apoptosis repressor with caspase recruitment domain modulates second mitochondrial-derived activator of caspases mimetic-induced cell death through BIRC2/MAP3K14 signalling in acute myeloid leukaemia.Br J Haematol. 2014 Nov;167(3):376-84. doi: 10.1111/bjh.13054. Epub 2014 Jul 31.
• [6] Alzheimer disease detection from structural MR images using FCM based weighted probabilistic neural network.Brain Imaging Behav. 2019 Feb;13(1):87-110. doi: 10.1007/s11682-018-9831-2.
• [7] Immunoglobulin D (IgD) and IgD receptor expression in diffuse large B-cell lymphoma.Hematology. 2019 Dec;24(1):544-551. doi: 10.1080/16078454.2019.1642553.
• [8] The use of flow cytometry in the diagnosis and biological characterization of the non-Hodgkin's lymphomas.Ann N Y Acad Sci. 1986;468:171-7. doi: 10.1111/j.1749-6632.1986.tb42038.x.
• [9] LMO4 inhibits p53-mediated proliferative inhibition of breast cancer cells through interacting p53.Life Sci. 2012 Sep 24;91(9-10):358-63. doi: 10.1016/j.lfs.2012.08.005. Epub 2012 Aug 11.
• [10] Partial trisomy 11, dup(11)(q23q13), as a defect characterizing lymphomas with Burkitt pathomorphology without MYC gene rearrangement.Med Oncol. 2011 Dec;28(4):1589-95. doi: 10.1007/s12032-010-9614-0. Epub 2010 Jul 27.
• [11] Three-color flow cytometry in the diagnosis of malignant lymphoma based on the comparative cell morphology of lymphoma cells and reactive lymphocytes.Leukemia. 1997 Nov;11(11):1891-903. doi: 10.1038/sj.leu.2400802.
• [12] Expression of apoptotic tumour necrosis factor receptor-associated factor, caspase recruitment domain and cell death-inducing DFF-45 effector genes in therapy-treated renal cell carcinoma.Nephrology (Carlton). 2009 Apr;14(2):205-12. doi: 10.1111/j.1440-1797.2008.01027.x.
• [13] Potent and selective NOP receptor activation reduces cocaine self-administration in rats by lowering hedonic set point.Addict Biol. 2020 Nov;25(6):e12844. doi: 10.1111/adb.12844. Epub 2019 Nov 10.
• [14] ARC (apoptosis repressor with caspase recruitment domain) is a novel marker of human colon cancer.Cell Cycle. 2008 Jun 1;7(11):1640-7. doi: 10.4161/cc.7.11.5979. Epub 2008 Mar 19.
• [15] Role of nociceptin/orphanin FQ and nociceptin opioid peptide receptor in depression and antidepressant effects of nociceptin opioid peptide receptor antagonists.Korean J Physiol Pharmacol. 2019 Nov;23(6):427-448. doi: 10.4196/kjpp.2019.23.6.427. Epub 2019 Oct 24.
• [16] Experiences of predictive testing in young people at risk of Huntington's disease, familial cardiomyopathy or hereditary breast and ovarian cancer.Eur J Hum Genet. 2014 Mar;22(3):396-401. doi: 10.1038/ejhg.2013.143. Epub 2013 Jul 17.
• [17] MiR-29a-5p inhibits proliferation and invasion and induces apoptosis in endometrial carcinoma via targeting TPX2.Cell Cycle. 2018;17(10):1268-1278. doi: 10.1080/15384101.2018.1475829. Epub 2018 Jul 23.
• [18] Gross genomic damage measured by DNA image cytometry independently predicts gastric cancer patient survival.Br J Cancer. 2009 Sep 15;101(6):1011-8. doi: 10.1038/sj.bjc.6605266.
• [19] Numerical aberrations of chromosomes 16, 17, and 18 in hepatocellular carcinoma: a FISH and FCM analysis of 20 cases.Dig Dis Sci. 1998 Jan;43(1):1-7. doi: 10.1023/a:1018838731634.
• [20] DNA content and chromosomal composition of malignant human gliomas.Neurol Clin. 1985 Nov;3(4):769-84.
• [21] Prognostic significance of DNA flow cytometric analysis in patients with nasopharyngeal carcinoma.Cancer. 1998 Dec 1;83(11):2284-92.
• [22] Transcriptional gene silencing of HPV16 E6/E7 induces growth inhibition via apoptosis in vitro and in vivo.Gynecol Oncol. 2012 Feb;124(2):296-302. doi: 10.1016/j.ygyno.2011.10.028. Epub 2011 Nov 3.
• [23] Nociceptin Receptor Is Overexpressed in Non-small Cell Lung Cancer and Predicts Poor Prognosis.Front Oncol. 2019 Apr 5;9:235. doi: 10.3389/fonc.2019.00235. eCollection 2019.
• [24] Anti-Parkinsonian and anti-dyskinetic profiles of two novel potent and selective nociceptin/orphanin FQ receptor agonists.Br J Pharmacol. 2018 Mar;175(5):782-796. doi: 10.1111/bph.14123. Epub 2018 Jan 31.
• [25] Decreased Nociceptin Receptors Are Related to Resilience and Recovery in College Women Who Have Experienced Sexual Violence: Therapeutic Implications for Posttraumatic Stress Disorder.Biol Psychiatry. 2019 Jun 15;85(12):1056-1064. doi: 10.1016/j.biopsych.2019.02.017. Epub 2019 Apr 4.
• [26] Reproducibility of FCM-DNA ploidy analysis in prostatic cancer: comparison between needle biopsy and surgical specimens.Anal Cell Pathol. 1993 Jan;5(1):17-21.
• [27] Long non-coding RNA (LncRNA) RMST in triple-negative breast cancer (TNBC): Expression analysis and biological roles research.J Cell Physiol. 2018 Oct;233(10):6603-6612. doi: 10.1002/jcp.26311. Epub 2018 Apr 17.
• [28] Mixed chimera status of 12 patients with Wiskott-Aldrich syndrome (WAS) after hematopoietic stem cell transplantation: evaluation by flow cytometric analysis of intracellular WAS protein expression.Blood. 2002 Aug 15;100(4):1208-14. doi: 10.1182/blood-2002-01-0211.
• [29] ARC is a critical cardiomyocyte survival switch in doxorubicin cardiotoxicity.J Mol Med (Berl). 2009 Apr;87(4):401-10. doi: 10.1007/s00109-008-0434-z. Epub 2009 Jan 13.
• [30] Analysis of the distribution of spinal NOP receptors in a chronic pain model using NOP-eGFP knock-in mice.Br J Pharmacol. 2018 Jul;175(13):2662-2675. doi: 10.1111/bph.14225. Epub 2018 May 6.
• [31] Familial cortical myoclonus with a mutation in NOL3. Ann Neurol. 2012 Aug;72(2):175-83. doi: 10.1002/ana.23666.
• [32] A QA Program for MRD Testing Demonstrates That Systematic Education Can Reduce Discordance Among Experienced Interpreters.Cytometry B Clin Cytom. 2018 Mar;94(2):239-249. doi: 10.1002/cyto.b.21528. Epub 2017 May 5.
• [33] -Arrestin 2 Promotes Hepatocyte Apoptosis by Inhibiting Akt Pathway in Alcoholic Liver Disease.Front Pharmacol. 2018 Sep 19;9:1031. doi: 10.3389/fphar.2018.01031. eCollection 2018.
• [34] Nociceptin/orphanin FQ (N/OFQ) modulates immunopathology and airway hyperresponsiveness representing a novel target for the treatment of asthma.Br J Pharmacol. 2016 Apr;173(8):1286-301. doi: 10.1111/bph.13416. Epub 2016 Mar 6.
• [35] DNA content and cell kinetics in colorectal carcinoma: flow cytometric analysis of primary tumor and liver metastases.Tumori. 1995 May-Jun;81(3 Suppl):12-5.
• [36] An Economic Evaluation of Iron Isomaltoside 1000 Versus Ferric Carboxymaltose in Patients with Inflammatory Bowel Disease and Iron Deficiency Anemia in Denmark.Adv Ther. 2018 Dec;35(12):2128-2137. doi: 10.1007/s12325-018-0827-5. Epub 2018 Nov 19.
• [37] Flow cytometry: its applications in hematology.Haematologica. 1995 Jan-Feb;80(1):69-81.
• [38] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [39] A new potent analgesic agent with reduced liability to produce morphine tolerance.Brain Res Bull. 2015 Aug;117:32-8. doi: 10.1016/j.brainresbull.2015.07.005. Epub 2015 Jul 30.
• [40] ARC is essential for maintaining pancreatic islet structure and -cell viability during type 2 diabetes.Sci Rep. 2017 Aug 1;7(1):7019. doi: 10.1038/s41598-017-07107-w.
• [41] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [42] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [43] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [44] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [45] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [46] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [47] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [48] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [49] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [50] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [51] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [52] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [53] Use of human neuroblastoma SH-SY5Y cells to evaluate glyphosate-induced effects on oxidative stress, neuronal development and cell death signaling pathways. Environ Int. 2020 Feb;135:105414. doi: 10.1016/j.envint.2019.105414. Epub 2019 Dec 23.
• [54] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [55] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [56] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [57] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [58] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [59] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.