Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6KEZUD)

• DOT Name: Follistatin-related protein 1 (FSTL1)
• Synonyms: Follistatin-like protein 1
• Gene Name: FSTL1
• Related Disease:
  Lung cancer
  Melanoma
  Acute coronary syndrome
  Acute kidney injury
  Advanced cancer
  Arthritis
  Carcinoma
  Cardiac failure
  Clear cell renal carcinoma
  Colon cancer
  Colorectal carcinoma
  Congestive heart failure
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioma
  Hepatocellular carcinoma
  Immune system disorder
  Lung adenocarcinoma
  Myocardial infarction
  Nasopharyngeal carcinoma
  Neoplasm
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Prostate carcinoma
  Pulmonary disease
  Pulmonary fibrosis
  Schizophrenia
  Squamous cell carcinoma
  Systemic sclerosis
  Asthma
  Colon carcinoma
  Gastric cancer
  Lung carcinoma
  Stomach cancer
  Systemic lupus erythematosus
  Glioblastoma multiforme
  Adult glioblastoma
  Bone osteosarcoma
  Cardiovascular disease
  Lupus nephritis
  Metastatic malignant neoplasm
  Obesity
  Osteosarcoma
  Pancreatic cancer
  Renal cell carcinoma
• UniProt ID: FSTL1_HUMAN
• Pfam ID: PF09289 ; PF07648
• Sequence:
  MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
  HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE
  LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
  ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
  ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
  KRVSTKEI
• Function: Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter. Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes. Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors.
• Tissue Specificity: Overexpressed in synovial tissues from rheumatoid arthritis .
• Reactome Pathway:
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Signaling by BMP (R-HSA-201451)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Altered Expression	[1]
Melanoma	DIS1RRCY	Definitive	Biomarker	[2]
Acute coronary syndrome	DIS7DYEW	Strong	Biomarker	[3]
Acute kidney injury	DISXZG0T	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Arthritis	DIST1YEL	Strong	Altered Expression	[6]
Carcinoma	DISH9F1N	Strong	Altered Expression	[7]
Cardiac failure	DISDC067	Strong	Biomarker	[3]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[3]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
Glioma	DIS5RPEH	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Immune system disorder	DISAEGPH	Strong	Biomarker	[15]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[16]
Myocardial infarction	DIS655KI	Strong	Biomarker	[17]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Altered Expression	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[19]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[20]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[11]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[11]
Prostate cancer	DISF190Y	Strong	Altered Expression	[21]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[21]
Pulmonary disease	DIS6060I	Strong	Biomarker	[22]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[23]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[24]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[25]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[26]
Asthma	DISW9QNS	moderate	Altered Expression	[27]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[9]
Gastric cancer	DISXGOUK	moderate	Biomarker	[28]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[1]
Stomach cancer	DISKIJSX	moderate	Biomarker	[28]
Systemic lupus erythematosus	DISI1SZ7	moderate	Biomarker	[29]
Glioblastoma multiforme	DISK8246	Disputed	Biomarker	[30]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[30]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[31]
Cardiovascular disease	DIS2IQDX	Limited	Biomarker	[32]
Lupus nephritis	DISCVGPZ	Limited	Altered Expression	[29]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[6]
Obesity	DIS47Y1K	Limited	Altered Expression	[32]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[31]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[33]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[34]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Follistatin-related protein 1 (FSTL1) affects the response to substance of Methotrexate.	[52]

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Follistatin-related protein 1 (FSTL1).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Follistatin-related protein 1 (FSTL1).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Follistatin-related protein 1 (FSTL1).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Follistatin-related protein 1 (FSTL1).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Follistatin-related protein 1 (FSTL1).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Follistatin-related protein 1 (FSTL1).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Follistatin-related protein 1 (FSTL1).	[41]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Follistatin-related protein 1 (FSTL1).	[42]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Follistatin-related protein 1 (FSTL1).	[43]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Follistatin-related protein 1 (FSTL1).	[45]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Follistatin-related protein 1 (FSTL1).	[46]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Follistatin-related protein 1 (FSTL1).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Follistatin-related protein 1 (FSTL1).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Follistatin-related protein 1 (FSTL1).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Follistatin-related protein 1 (FSTL1).	[50]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Follistatin-related protein 1 (FSTL1).	[51]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Follistatin-related protein 1 (FSTL1).	[44]

References

• [1] Follistatin-like Protein 1 Inhibits Lung Cancer Metastasis by Preventing Proteolytic Activation of Osteopontin.Cancer Res. 2019 Dec 15;79(24):6113-6125. doi: 10.1158/0008-5472.CAN-19-0842. Epub 2019 Oct 25.
• [2] Novel circular RNA, hsa_circ_0025039 promotes cell growth, invasion and glucose metabolism in malignant melanoma via the miR-198/CDK4 axis.Biomed Pharmacother. 2018 Dec;108:165-176. doi: 10.1016/j.biopha.2018.08.152. Epub 2018 Sep 13.
• [3] Follistatin-like 1 in Cardiovascular Disease and Inflammation.Mini Rev Med Chem. 2019;19(16):1379-1389. doi: 10.2174/1389557519666190312161551.
• [4] Follistatin-like 1 regulates renal IL-1 expression in cisplatin nephrotoxicity.Am J Physiol Renal Physiol. 2010 Dec;299(6):F1320-7. doi: 10.1152/ajprenal.00325.2010. Epub 2010 Sep 22.
• [5] Follistatinlike protein 1 knockdown elicits human gastric cancer cell apoptosis via a STAT6dependent pathway.Oncol Rep. 2019 Dec;42(6):2806-2813. doi: 10.3892/or.2019.7334. Epub 2019 Sep 24.
• [6] Follistatin-like 1 in development and human diseases.Cell Mol Life Sci. 2018 Jul;75(13):2339-2354. doi: 10.1007/s00018-018-2805-0. Epub 2018 Mar 29.
• [7] Cloning of the mRNA of overexpression in colon carcinoma-1: a sequence overexpressed in a subset of colon carcinomas.Cancer Genet Cytogenet. 2002 Feb;133(1):55-60. doi: 10.1016/s0165-4608(01)00634-3.
• [8] Follistatin-like protein 1 plays a tumor suppressor role in clear-cell renal cell carcinoma.Chin J Cancer. 2018 Jan 22;37(1):2. doi: 10.1186/s40880-018-0267-2.
• [9] Follistatin-like protein 1 sustains colon cancer cell growth and survival.Oncotarget. 2018 Jul 27;9(58):31278-31290. doi: 10.18632/oncotarget.25811. eCollection 2018 Jul 27.
• [10] MiR-198 affects the proliferation and apoptosis of colorectal cancer through regulation of ADAM28/JAK-STAT signaling pathway.Eur Rev Med Pharmacol Sci. 2019 Feb;23(4):1487-1493. doi: 10.26355/eurrev_201902_17106.
• [11] The oncogenic phosphatase PPM1D confers cisplatin resistance in ovarian carcinoma cells by attenuating checkpoint kinase 1 and p53 activation.Oncogene. 2012 Apr 26;31(17):2175-86. doi: 10.1038/onc.2011.399. Epub 2011 Sep 19.
• [12] FSTL1 Promotes Metastasis and Chemoresistance in Esophageal Squamous Cell Carcinoma through NFB-BMP Signaling Cross-talk.Cancer Res. 2017 Nov 1;77(21):5886-5899. doi: 10.1158/0008-5472.CAN-17-1411. Epub 2017 Sep 7.
• [13] Fstl1 Promotes Glioma Growth Through the BMP4/Smad1/5/8 Signaling Pathway.Cell Physiol Biochem. 2017;44(4):1616-1628. doi: 10.1159/000485759. Epub 2017 Dec 6.
• [14] FSTL1 contributes to tumor progression via attenuating apoptosis in a AKT/GSK-3 - dependent manner in hepatocellular carcinoma.Cancer Biomark. 2017 Jul 19;20(1):75-85. doi: 10.3233/CBM-170132.
• [15] Blocking the FSTL1-DIP2A Axis Improves Anti-tumor Immunity.Cell Rep. 2018 Aug 14;24(7):1790-1801. doi: 10.1016/j.celrep.2018.07.043.
• [16] Clinical value of microRNA-198-5p downregulation in lung adenocarcinoma and its potential pathways.Oncol Lett. 2019 Sep;18(3):2939-2954. doi: 10.3892/ol.2019.10610. Epub 2019 Jul 12.
• [17] Inhibition of MicroRNA-9-5p Protects Against Cardiac Remodeling Following Myocardial Infarction in Mice.Hum Gene Ther. 2019 Mar;30(3):286-301. doi: 10.1089/hum.2018.059. Epub 2018 Oct 31.
• [18] Follistatin-Like Protein-1 Upregulates Dendritic Cell-Based Immunity in Patients with Nasopharyngeal Carcinoma.J Interferon Cytokine Res. 2017 Nov;37(11):494-502. doi: 10.1089/jir.2017.0064.
• [19] Selective Capture and Purification of MicroRNAs and Intracellular Proteins through Antisense-vectorized Magnetic Nanobeads.Sci Rep. 2019 Feb 14;9(1):2069. doi: 10.1038/s41598-019-39575-7.
• [20] Validation of the Diagnostic and Prognostic Values of ADAMTS5 and FSTL1 in Osteoarthritis Rat Model.Cartilage. 2021 Dec;13(2_suppl):1263S-1273S. doi: 10.1177/1947603519852405. Epub 2019 Jun 10.
• [21] MicroRNA?98 suppresses prostate tumorigenesis by targeting MIB1.Oncol Rep. 2019 Sep;42(3):1047-1056. doi: 10.3892/or.2019.7234. Epub 2019 Jul 15.
• [22] FSTL-1 Attenuation Causes Spontaneous Smoke-Resistant Pulmonary Emphysema.Am J Respir Crit Care Med. 2020 Apr 15;201(8):934-945. doi: 10.1164/rccm.201905-0973OC.
• [23] Haplodeletion of Follistatin-Like 1 Attenuates Radiation-Induced Pulmonary Fibrosis in Mice.Int J Radiat Oncol Biol Phys. 2019 Jan 1;103(1):208-216. doi: 10.1016/j.ijrobp.2018.08.035. Epub 2018 Aug 29.
• [24] Brain expressed microRNAs implicated in schizophrenia etiology.PLoS One. 2007 Sep 12;2(9):e873. doi: 10.1371/journal.pone.0000873.
• [25] Decrease of FSTL1-BMP4-Smad signaling predicts poor prognosis in lung adenocarcinoma but not in squamous cell carcinoma.Sci Rep. 2017 Aug 29;7(1):9830. doi: 10.1038/s41598-017-10366-2.
• [26] Histone Deacetylase 5 Is Overexpressed in Scleroderma Endothelial Cells and Impairs Angiogenesis via Repression of Proangiogenic Factors.Arthritis Rheumatol. 2016 Dec;68(12):2975-2985. doi: 10.1002/art.39828.
• [27] The Correlation between FSTL1 Expression and Airway Remodeling in Asthmatics.Mediators Inflamm. 2017;2017:7918472. doi: 10.1155/2017/7918472. Epub 2017 Aug 3.
• [28] Circular RNA AKT3 upregulates PIK3R1 to enhance cisplatin resistance in gastric cancer via miR-198 suppression.Mol Cancer. 2019 Mar 30;18(1):71. doi: 10.1186/s12943-019-0969-3.
• [29] MicroRNA?98 contributes to lupus nephritis progression by inhibition of phosphatase and tensin homology deleted on chromosome ten expression.Mol Med Rep. 2017 Nov;16(5):7813-7820. doi: 10.3892/mmr.2017.7527. Epub 2017 Sep 19.
• [30] Assessment of ApoC1, LuzP6, C12orf75 and OCC-1 in cystic glioblastoma using MALDI-TOF mass spectrometry, immunohistochemistry and qRT-PCR.Med Mol Morphol. 2019 Dec;52(4):217-225. doi: 10.1007/s00795-019-00223-8. Epub 2019 Apr 20.
• [31] Loss of miR-198 and -206 during primary tumor progression enables metastatic dissemination in human osteosarcoma.Oncotarget. 2018 Nov 6;9(87):35726-35741. doi: 10.18632/oncotarget.26284. eCollection 2018 Nov 6.
• [32] High circulating follistatin-like protein 1 as a biomarker of a metabolically unhealthy state.Endocr J. 2019 Mar 28;66(3):241-251. doi: 10.1507/endocrj.EJ18-0352. Epub 2019 Feb 8.
• [33] A holistic approach to dissecting SPARC family protein complexity reveals FSTL-1 as an inhibitor of pancreatic cancer cell growth.Sci Rep. 2016 Nov 25;6:37839. doi: 10.1038/srep37839.
• [34] miR-29b and miR-198 overexpression in CD8+ T cells of renal cell carcinoma patients down-modulates JAK3 and MCL-1 leading to immune dysfunction.J Transl Med. 2016 Apr 11;14:84. doi: 10.1186/s12967-016-0841-9.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [38] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [42] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [43] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [44] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [45] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [46] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [47] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [51] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [52] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.