Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7Y8EJ2)

• DOT Name: Zinc finger protein SNAI2 (SNAI2)
• Synonyms: Neural crest transcription factor Slug; Protein snail homolog 2
• Gene Name: SNAI2
• Related Disease:
  Esophageal cancer
  Neoplasm of esophagus
  Adenocarcinoma
  Arteriosclerosis
  Atherosclerosis
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Calcinosis
  Carcinoma
  Cholangiocarcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Epithelial ovarian cancer
  Familial tumoral calcinosis
  Glioblastoma multiforme
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Melanoma
  Metastatic malignant neoplasm
  Neuroblastoma
  Osteosarcoma
  Ovarian cancer
  Piebaldism
  Prostate neoplasm
  Renal cell carcinoma
  Squamous cell carcinoma
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Waardenburg syndrome type 2D
  Gastric cancer
  Stomach cancer
  Triple negative breast cancer
  Waardenburg syndrome type 2
  Adult glioblastoma
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Glioma
  Non-small-cell lung cancer
  Ovarian neoplasm
  Waardenburg syndrome
  Waardenburg syndrome type 1
  Waardenburg syndrome type 3
• UniProt ID: SNAI2_HUMAN
• Pfam ID: PF00096
• Sequence:
  MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
  TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
  HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
  HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
  YQCKNCSKTFSRMSLLHKHEESGCCVAH
• Function: Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.
• Tissue Specificity: Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level).
• KEGG Pathway:
  Hippo sig.ling pathway (hsa04390)
  Adherens junction (hsa04520)
• Reactome Pathway: Regulation of PTEN gene transcription (R-HSA-8943724)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal cancer	DISGB2VN	Definitive	Biomarker	[1]
Neoplasm of esophagus	DISOLKAQ	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[3]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[3]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Calcinosis	DISQP4OR	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	Strong	Biomarker	[8]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Colorectal neoplasm	DISR1UCN	Strong	Altered Expression	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[12]
Familial tumoral calcinosis	DISYJZKG	Strong	Biomarker	[7]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[13]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[15]
Lung cancer	DISCM4YA	Strong	Altered Expression	[16]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[16]
Melanoma	DIS1RRCY	Strong	Altered Expression	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[18]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[19]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[4]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[12]
Piebaldism	DISDLDF2	Strong	Autosomal dominant	[20]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[21]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[22]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[23]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[24]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[25]
Waardenburg syndrome type 2D	DISHVL0O	Strong	Autosomal recessive	[26]
Gastric cancer	DISXGOUK	moderate	Biomarker	[27]
Stomach cancer	DISKIJSX	moderate	Biomarker	[27]
Triple negative breast cancer	DISAMG6N	moderate	Altered Expression	[28]
Waardenburg syndrome type 2	DISVZBEV	Supportive	Autosomal dominant	[26]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[29]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[30]
Colon cancer	DISVC52G	Limited	Biomarker	[31]
Colon carcinoma	DISJYKUO	Limited	Biomarker	[31]
Glioma	DIS5RPEH	Limited	Biomarker	[32]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Altered Expression	[33]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[34]
Waardenburg syndrome	DISRU41A	Limited	Autosomal recessive	[35]
Waardenburg syndrome type 1	DIS8DBQ5	Limited	Biomarker	[26]
Waardenburg syndrome type 3	DIS4JF16	Limited	Biomarker	[26]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Gefitinib	DM15F0X	Approved	Zinc finger protein SNAI2 (SNAI2) affects the response to substance of Gefitinib.	[94]

61 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Zinc finger protein SNAI2 (SNAI2).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Zinc finger protein SNAI2 (SNAI2).	[41]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Zinc finger protein SNAI2 (SNAI2).	[42]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[44]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Zinc finger protein SNAI2 (SNAI2).	[45]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Zinc finger protein SNAI2 (SNAI2).	[46]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Zinc finger protein SNAI2 (SNAI2).	[47]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Zinc finger protein SNAI2 (SNAI2).	[46]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Zinc finger protein SNAI2 (SNAI2).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Zinc finger protein SNAI2 (SNAI2).	[49]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[50]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Zinc finger protein SNAI2 (SNAI2).	[51]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Zinc finger protein SNAI2 (SNAI2).	[52]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Zinc finger protein SNAI2 (SNAI2).	[47]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[53]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[54]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Zinc finger protein SNAI2 (SNAI2).	[55]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Zinc finger protein SNAI2 (SNAI2).	[56]
Palbociclib	DMD7L94	Approved	Palbociclib increases the expression of Zinc finger protein SNAI2 (SNAI2).	[57]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[58]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[59]
Ketamine	DMT5HA4	Approved	Ketamine increases the expression of Zinc finger protein SNAI2 (SNAI2).	[60]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Zinc finger protein SNAI2 (SNAI2).	[61]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Zinc finger protein SNAI2 (SNAI2).	[62]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[63]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[64]
Thymoquinone	DMVDTR2	Phase 2/3	Thymoquinone decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[65]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Zinc finger protein SNAI2 (SNAI2).	[47]
Delphinidin	DMS2WIN	Phase 2	Delphinidin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[66]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[68]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Zinc finger protein SNAI2 (SNAI2).	[69]
Acteoside	DM0YHKB	Terminated	Acteoside decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[70]
EMBELIN	DMFZO4Y	Terminated	EMBELIN decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[71]
Pifithrin-alpha	DM63OD7	Terminated	Pifithrin-alpha increases the expression of Zinc finger protein SNAI2 (SNAI2).	[72]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[73]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Zinc finger protein SNAI2 (SNAI2).	[74]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[75]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Zinc finger protein SNAI2 (SNAI2).	[76]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[77]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[78]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[79]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Zinc finger protein SNAI2 (SNAI2).	[80]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Zinc finger protein SNAI2 (SNAI2).	[81]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN affects the expression of Zinc finger protein SNAI2 (SNAI2).	[82]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[83]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Zinc finger protein SNAI2 (SNAI2).	[84]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Zinc finger protein SNAI2 (SNAI2).	[85]
Cordycepin	DM72Y01	Investigative	Cordycepin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[65]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the expression of Zinc finger protein SNAI2 (SNAI2).	[86]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[87]
gingerol	DMNXYSM	Investigative	gingerol decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[88]
MANGIFERIN	DMWAF5Z	Investigative	MANGIFERIN decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[89]
Tetramethylbutylphenol	DMW9CH2	Investigative	Tetramethylbutylphenol increases the expression of Zinc finger protein SNAI2 (SNAI2).	[90]
Isoarnebin 4	DM0B7NO	Investigative	Isoarnebin 4 decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[91]
NMS-873	DMYKZ6U	Investigative	NMS-873 decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[92]
HONOKIOL	DMJWT3X	Investigative	HONOKIOL decreases the expression of Zinc finger protein SNAI2 (SNAI2).	[93]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Zinc finger protein SNAI2 (SNAI2).	[67]

References

• [1] Discovery of deregulation of zinc homeostasis and its associated genes in esophageal squamous cell carcinoma using cDNA microarray.Int J Cancer. 2007 Jan 15;120(2):230-42. doi: 10.1002/ijc.22246.
• [2] SNAI2/Slug gene is silenced in prostate cancer and regulates neuroendocrine differentiation, metastasis-suppressor and pluripotency gene expression.Oncotarget. 2015 Jul 10;6(19):17121-34. doi: 10.18632/oncotarget.2736.
• [3] Conditional knockout of TFPI-1 in VSMCs of mice accelerates atherosclerosis by enhancing AMOT/YAP pathway.Int J Cardiol. 2017 Feb 1;228:605-614. doi: 10.1016/j.ijcard.2016.11.195. Epub 2016 Nov 12.
• [4] MicroRNA-124 acts as a tumor-suppressive miRNA by inhibiting the expression of Snail2 in osteosarcoma.Oncol Lett. 2018 Apr;15(4):4979-4987. doi: 10.3892/ol.2018.7994. Epub 2018 Feb 8.
• [5] Estrogen receptor--miR-1271-SNAI2 feedback loop regulates transforming growth factor--induced breast cancer progression.J Exp Clin Cancer Res. 2019 Mar 1;38(1):109. doi: 10.1186/s13046-019-1112-4.
• [6] Sphingosine 1-phosphate signaling induces SNAI2 expression to promote cell invasion in breast cancer cells.FASEB J. 2019 Jun;33(6):7180-7191. doi: 10.1096/fj.201801635R. Epub 2019 Mar 7.
• [7] Low-level overexpression of p53 promotes warfarin-induced calcification of porcine aortic valve interstitial cells by activating Slug gene transcription.J Biol Chem. 2018 Mar 9;293(10):3780-3792. doi: 10.1074/jbc.M117.791145. Epub 2018 Jan 22.
• [8] The miR-203/SNAI2 axis regulates prostate tumor growth, migration, angiogenesis and stemness potentially by modulating GSK-3/-CATENIN signal pathway.IUBMB Life. 2018 Mar;70(3):224-236. doi: 10.1002/iub.1720. Epub 2018 Feb 1.
• [9] RNA interference targeting slug increases cholangiocarcinoma cell sensitivity to cisplatin via upregulating PUMA.Int J Mol Sci. 2011 Jan 14;12(1):385-400. doi: 10.3390/ijms12010385.
• [10] SNAIL- and SLUG-induced side population phenotype of HCT116 human colorectal cancer cells and its regulation by BET inhibitors.Biochem Biophys Res Commun. 2020 Jan 1;521(1):152-157. doi: 10.1016/j.bbrc.2019.10.094. Epub 2019 Oct 22.
• [11] The transcription factors Snail1 and Snail2 repress vitamin D receptor during colon cancer progression.J Steroid Biochem Mol Biol. 2010 Jul;121(1-2):106-9. doi: 10.1016/j.jsbmb.2010.01.014. Epub 2010 Feb 6.
• [12] SNAI1 recruits HDAC1 to suppress SNAI2 transcription during epithelial to mesenchymal transition.Sci Rep. 2019 Jun 5;9(1):8295. doi: 10.1038/s41598-019-44826-8.
• [13] SLUG Directs the Precursor State of Human Brain Tumor Stem Cells.Cancers (Basel). 2019 Oct 24;11(11):1635. doi: 10.3390/cancers11111635.
• [14] Np63/SRC/Slug Signaling Axis Promotes Epithelial-to-Mesenchymal Transition in Squamous Cancers.Clin Cancer Res. 2018 Aug 15;24(16):3917-3927. doi: 10.1158/1078-0432.CCR-17-3775. Epub 2018 May 8.
• [15] Transcriptionally Active Androgen Receptor Splice Variants Promote Hepatocellular Carcinoma Progression.Cancer Res. 2020 Feb 1;80(3):561-575. doi: 10.1158/0008-5472.CAN-19-1117. Epub 2019 Nov 4.
• [16] Hypoxia-induced Slug SUMOylation enhances lung cancer metastasis.J Exp Clin Cancer Res. 2019 Jan 6;38(1):5. doi: 10.1186/s13046-018-0996-8.
• [17] STAM-binding protein regulates melanoma metastasis through SLUG stabilization.Biochem Biophys Res Commun. 2018 Dec 9;507(1-4):484-488. doi: 10.1016/j.bbrc.2018.11.068. Epub 2018 Nov 16.
• [18] G9a and histone deacetylases are crucial for Snail2-mediated E-cadherin repression and metastasis in hepatocellular carcinoma.Cancer Sci. 2019 Nov;110(11):3442-3452. doi: 10.1111/cas.14173. Epub 2019 Sep 19.
• [19] Prokineticin signaling is required for the maintenance of a de novo population of c-KIT?cells to sustain neuroblastoma progression.Oncogene. 2015 Feb 19;34(8):1019-34. doi: 10.1038/onc.2014.24. Epub 2014 Mar 17.
• [20] Deletion of the SLUG (SNAI2) gene results in human piebaldism. Am J Med Genet A. 2003 Oct 1;122A(2):125-32. doi: 10.1002/ajmg.a.20345.
• [21] The PCAT3/PCAT9-miR-203-SNAI2 axis functions as a key mediator for prostate tumor growth and progression.Oncotarget. 2018 Jan 12;9(15):12212-12225. doi: 10.18632/oncotarget.24198. eCollection 2018 Feb 23.
• [22] LncRNA NONHSAT113026 represses renal cell carcinoma tumorigenesis through interacting with NF-B/p50 and SLUG.Biomed Pharmacother. 2019 Oct;118:109382. doi: 10.1016/j.biopha.2019.109382. Epub 2019 Aug 28.
• [23] Differential BMI1, TWIST1, SNAI2 mRNA expression pattern correlation with malignancy type in a spectrum of common cutaneous malignancies: basal cell carcinoma, squamous cell carcinoma, and melanoma.Clin Transl Oncol. 2017 Apr;19(4):489-497. doi: 10.1007/s12094-016-1555-4. Epub 2016 Oct 7.
• [24] Lysyl Oxidase (LOX) Transcriptionally Regulates SNAI2 Expression and TIMP4 Secretion in Human Cancers.Clin Cancer Res. 2016 Sep 1;22(17):4491-504. doi: 10.1158/1078-0432.CCR-15-2461. Epub 2016 Mar 30.
• [25] Down-regulation of 14q32-encoded miRNAs and tumor suppressor role for miR-654-3p in papillary thyroid cancer.Oncotarget. 2017 Feb 7;8(6):9597-9607. doi: 10.18632/oncotarget.14162.
• [26] SLUG (SNAI2) deletions in patients with Waardenburg disease. Hum Mol Genet. 2002 Dec 1;11(25):3231-6. doi: 10.1093/hmg/11.25.3231.
• [27] P4HA3 is Epigenetically Activated by Slug in Gastric Cancer and its Deregulation is Associated With Enhanced Metastasis and Poor Survival.Technol Cancer Res Treat. 2018 Jan 1;17:1533033818796485. doi: 10.1177/1533033818796485.
• [28] cIAP1 regulates the EGFR/Snai2 axis in triple-negative breast cancer cells.Cell Death Differ. 2018 Dec;25(12):2147-2164. doi: 10.1038/s41418-018-0100-0. Epub 2018 Apr 19.
• [29] Roles of zinc-fingers and homeoboxes 1 during the proliferation, migration, and invasion of glioblastoma cells.Tumour Biol. 2017 Mar;39(3):1010428317694575. doi: 10.1177/1010428317694575.
• [30] TOX3 inhibits cancer cell migration and invasion via transcriptional regulation of SNAI1 and SNAI2 in clear cell renal cell carcinoma.Cancer Lett. 2019 May 1;449:76-86. doi: 10.1016/j.canlet.2019.02.020. Epub 2019 Feb 14.
• [31] Modulation of the colon cancer cell phenotype by pro-inflammatory macrophages: A preclinical model of surgery-associated inflammation and tumor recurrence.PLoS One. 2018 Feb 20;13(2):e0192958. doi: 10.1371/journal.pone.0192958. eCollection 2018.
• [32] The Role Played by SLUG, an Epithelial-Mesenchymal Transition Factor, in Invasion and Therapeutic Resistance of Malignant Glioma.Cell Mol Neurobiol. 2019 Aug;39(6):769-782. doi: 10.1007/s10571-019-00677-5. Epub 2019 Apr 22.
• [33] Ginsenoside Rg3 promotes the antitumor activity of gefitinib in lung cancer cell lines.Exp Ther Med. 2019 Jan;17(1):953-959. doi: 10.3892/etm.2018.7001. Epub 2018 Nov 21.
• [34] Systematic analyses reveal long non-coding RNA (PTAF)-mediated promotion of EMT and invasion-metastasis in serous ovarian cancer.Mol Cancer. 2018 Jun 21;17(1):96. doi: 10.1186/s12943-018-0844-7.
• [35] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [38] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [39] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [40] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [41] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [42] Bisphenol A and nonylphenol have the potential to stimulate the migration of ovarian cancer cells by inducing epithelial-mesenchymal transition via an estrogen receptor dependent pathway. Chem Res Toxicol. 2015 Apr 20;28(4):662-71. doi: 10.1021/tx500443p. Epub 2015 Mar 3.
• [43] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [44] Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
• [45] Manganese superoxide dismutase induces migration and invasion of tongue squamous cell carcinoma via H2O2-dependent Snail signaling. Free Radic Biol Med. 2012 Jul 1;53(1):44-50. doi: 10.1016/j.freeradbiomed.2012.04.031. Epub 2012 May 9.
• [46] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [47] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [48] Inhibitory effects of 3,3'-diindolylmethane on epithelial-mesenchymal transition induced by endocrine disrupting chemicals in cellular and xenograft mouse models of breast cancer. Food Chem Toxicol. 2017 Nov;109(Pt 1):284-295. doi: 10.1016/j.fct.2017.08.037. Epub 2017 Aug 24.
• [49] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [50] Epigenetic silencing of SFRP5 promotes the metastasis and invasion of chondrosarcoma by expression inhibition and Wnt signaling pathway activation. Chem Biol Interact. 2018 Dec 25;296:1-8. doi: 10.1016/j.cbi.2018.08.020. Epub 2018 Aug 18.
• [51] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [52] Resveratrol induces chemosensitization to 5-fluorouracil through up-regulation of intercellular junctions, Epithelial-to-mesenchymal transition and apoptosis in colorectal cancer. Biochem Pharmacol. 2015 Nov 1;98(1):51-68. doi: 10.1016/j.bcp.2015.08.105. Epub 2015 Aug 24.
• [53] WNT7A/-catenin signaling induces FGF1 and influences sensitivity to niclosamide in ovarian cancer. Oncogene. 2015 Jun;34(26):3452-62. doi: 10.1038/onc.2014.277. Epub 2014 Sep 1.
• [54] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [55] Enhancement of cancer stem-like and epithelial-mesenchymal transdifferentiation property in oral epithelial cells with long-term nicotine exposure: reversal by targeting SNAIL. Toxicol Appl Pharmacol. 2013 Feb 1;266(3):459-69.
• [56] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [57] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [58] Destruxin B inhibits hepatocellular carcinoma cell growth through modulation of the Wnt/-catenin signaling pathway and epithelial-mesenchymal transition. Toxicol In Vitro. 2014 Jun;28(4):552-61. doi: 10.1016/j.tiv.2014.01.002. Epub 2014 Jan 13.
• [59] Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
• [60] Ketamine-induced bladder fibrosis involves epithelial-to-mesenchymal transition mediated by transforming growth factor-1. Am J Physiol Renal Physiol. 2017 Oct 1;313(4):F961-F972. doi: 10.1152/ajprenal.00686.2016. Epub 2017 Mar 22.
• [61] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [62] Androgen regulation of prostasin gene expression is mediated by sterol-regulatory element-binding proteins and SLUG. Prostate. 2006 Jun 15;66(9):911-20. doi: 10.1002/pros.20325.
• [63] Resveratrol inhibits pancreatic cancer stem cell characteristics in human and KrasG12D transgenic mice by inhibiting pluripotency maintaining factors and epithelial-mesenchymal transition. PLoS One. 2011 Jan 31;6(1):e16530. doi: 10.1371/journal.pone.0016530.
• [64] Potent growth suppressive activity of curcumin in human breast cancer cells: Modulation of Wnt/beta-catenin signaling. Chem Biol Interact. 2009 Oct 7;181(2):263-71. doi: 10.1016/j.cbi.2009.06.012. Epub 2009 Jun 30.
• [65] Cordycepin Inhibits Triple-Negative Breast Cancer Cell Migration and Invasion by Regulating EMT-TFs SLUG, TWIST1, SNAIL1, and ZEB1. Front Oncol. 2022 Jun 14;12:898583. doi: 10.3389/fonc.2022.898583. eCollection 2022.
• [66] Delphinidin induces apoptosis and inhibits epithelial-to-mesenchymal transition via the ERK/p38 MAPK-signaling pathway in human osteosarcoma cell lines. Environ Toxicol. 2018 Jun;33(6):640-649. doi: 10.1002/tox.22548. Epub 2018 Feb 16.
• [67] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [68] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [69] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [70] Verbascoside inhibits the epithelial-mesenchymal transition of prostate cancer cells through high-mobility group box 1/receptor for advanced glycation end-products/TGF- pathway. Environ Toxicol. 2021 Jun;36(6):1080-1089. doi: 10.1002/tox.23107. Epub 2021 Feb 1.
• [71] Embelin suppresses growth of human pancreatic cancer xenografts, and pancreatic cancer cells isolated from KrasG12D mice by inhibiting Akt and Sonic hedgehog pathways. PLoS One. 2014 Apr 2;9(4):e92161.
• [72] The vicious cycle between ferritinophagy and ROS production triggered EMT inhibition of gastric cancer cells was through p53/AKT/mTor pathway. Chem Biol Interact. 2020 Sep 1;328:109196. doi: 10.1016/j.cbi.2020.109196. Epub 2020 Jul 18.
• [73] Low dose of bisphenol a modulates ovarian cancer gene expression profile and promotes epithelial to mesenchymal transition via canonical Wnt pathway. Toxicol Sci. 2018 Aug 1;164(2):527-538.
• [74] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [75] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [76] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [77] A synthetic coumarin derivative (4-flourophenylacetamide-acetyl coumarin) impedes cell cycle at G0/G1 stage, induces apoptosis, and inhibits metastasis via ROS-mediated p53 and AKT signaling pathways in A549 cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22553. doi: 10.1002/jbt.22553. Epub 2020 Jun 24.
• [78] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [79] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [80] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [81] Nickel-induced epithelial-mesenchymal transition by reactive oxygen species generation and E-cadherin promoter hypermethylation. J Biol Chem. 2012 Jul 20;287(30):25292-302.
• [82] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [83] GLI inhibitors overcome Erlotinib resistance in human pancreatic cancer cells by modulating E-cadherin. J Chemother. 2019 May;31(3):141-149. doi: 10.1080/1120009X.2019.1584422. Epub 2019 Apr 14.
• [84] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [85] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [86] The cigarette smoke components induced the cell proliferation and epithelial to mesenchymal transition via production of reactive oxygen species in endometrial adenocarcinoma cells. Food Chem Toxicol. 2018 Nov;121:657-665. doi: 10.1016/j.fct.2018.09.023. Epub 2018 Sep 17.
• [87] Chrysin inhibits metastatic potential of human triple-negative breast cancer cells by modulating matrix metalloproteinase-10, epithelial to mesenchymal transition, and PI3K/Akt signaling pathway. J Appl Toxicol. 2014 Jan;34(1):105-12. doi: 10.1002/jat.2941. Epub 2013 Oct 10.
• [88] 6-Gingerol suppresses tumor cell metastasis by increasing YAP(ser127) phosphorylation in renal cell carcinoma. J Biochem Mol Toxicol. 2021 Jan;35(1):e22609. doi: 10.1002/jbt.22609. Epub 2020 Sep 14.
• [89] Mangiferin exerts antitumor activity in breast cancer cells by regulating matrix metalloproteinases, epithelial to mesenchymal transition, and -catenin signaling pathway. Toxicol Appl Pharmacol. 2013 Oct 1;272(1):180-90. doi: 10.1016/j.taap.2013.05.011. Epub 2013 May 22.
• [90] Effect of benzophenone-1 and octylphenol on the regulation of epithelial-mesenchymal transition via an estrogen receptor-dependent pathway in estrogen receptor expressing ovarian cancer cells. Food Chem Toxicol. 2016 Jul;93:58-65. doi: 10.1016/j.fct.2016.04.026. Epub 2016 May 1.
• [91] Shikonin suppresses small cell lung cancer growth via inducing ATF3-mediated ferroptosis to promote ROS accumulation. Chem Biol Interact. 2023 Sep 1;382:110588. doi: 10.1016/j.cbi.2023.110588. Epub 2023 Jun 1.
• [92] Interleukin-6 induced overexpression of valosin-containing protein (VCP)/p97 is associated with androgen-independent prostate cancer (AIPC) progression. J Cell Physiol. 2018 Oct;233(10):7148-7164. doi: 10.1002/jcp.26639. Epub 2018 Apr 25.
• [93] Targeting histone deacetylase-3 blocked epithelial-mesenchymal plasticity and metastatic dissemination in gastric cancer. Cell Biol Toxicol. 2023 Oct;39(5):1873-1896. doi: 10.1007/s10565-021-09673-2. Epub 2022 Jan 1.
• [94] Slug confers resistance to the epidermal growth factor receptor tyrosine kinase inhibitor. Am J Respir Crit Care Med. 2011 Apr 15;183(8):1071-9. doi: 10.1164/rccm.201009-1440OC. Epub 2010 Oct 29.