Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9YB2SA)

DOT Name	GA-binding protein alpha chain (GABPA)
Synonyms	GABP subunit alpha; Nuclear respiratory factor 2 subunit alpha; Transcription factor E4TF1-60
Gene Name	GABPA
Related Disease	Lung carcinoma ( ) Adult glioblastoma ( ) Alzheimer disease ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Cardiomyopathy ( ) Cardiovascular disease ( ) Cerebral infarction ( ) Chronic kidney disease ( ) Chronic obstructive pulmonary disease ( ) Colon cancer ( ) Colon carcinoma ( ) Depression ( ) Diabetic kidney disease ( ) Dilated cardiomyopathy 1A ( ) Epithelial ovarian cancer ( ) Fatty liver disease ( ) Glioblastoma multiforme ( ) Glioma ( ) Hepatocellular carcinoma ( ) High blood pressure ( ) Huntington disease ( ) Hyperglycemia ( ) Lung adenocarcinoma ( ) Lung cancer ( ) Myocardial infarction ( ) Nephropathy ( ) Neuralgia ( ) Neuroblastoma ( ) Non-alcoholic steatohepatitis ( ) Obesity ( ) Osteoarthritis ( ) Pancreatic cancer ( ) Prostate cancer ( ) Prostate carcinoma ( ) Pulmonary fibrosis ( ) Sickle-cell anaemia ( ) Stroke ( ) Thyroid gland papillary carcinoma ( ) Vascular disease ( ) B-cell neoplasm ( ) Colitis ( ) Lung neoplasm ( ) Type-1/2 diabetes ( ) Non-alcoholic fatty liver disease ( ) Pulmonary emphysema ( ) Renal fibrosis ( ) Ulcerative colitis ( )
UniProt ID	GABPA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00178 ; PF11620 ; PF02198
Sequence	MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Function	Transcription factor capable of interacting with purine rich repeats (GA repeats). Positively regulates transcription of transcriptional repressor RHIT/ZNF205 ; (Microbial infection) Necessary for the expression of the Adenovirus E4 gene.
Reactome Pathway	Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[3]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[4]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[4]
Cardiomyopathy	DISUPZRG	Strong	Biomarker	[5]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[6]
Cerebral infarction	DISR1WNP	Strong	Altered Expression	[7]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[8]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Altered Expression	[10]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[10]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[12]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[14]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[15]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Glioma	DIS5RPEH	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[6]
Huntington disease	DISQPLA4	Strong	Biomarker	[17]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[18]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[19]
Lung cancer	DISCM4YA	Strong	Altered Expression	[20]
Myocardial infarction	DIS655KI	Strong	Altered Expression	[21]
Nephropathy	DISXWP4P	Strong	Biomarker	[22]
Neuralgia	DISWO58J	Strong	Biomarker	[23]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[24]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[25]
Obesity	DIS47Y1K	Strong	Biomarker	[26]
Osteoarthritis	DIS05URM	Strong	Genetic Variation	[27]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[28]
Prostate cancer	DISF190Y	Strong	Biomarker	[29]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[29]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[30]
Sickle-cell anaemia	DIS5YNZB	Strong	Biomarker	[31]
Stroke	DISX6UHX	Strong	Biomarker	[7]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[32]
Vascular disease	DISVS67S	Strong	Biomarker	[33]
B-cell neoplasm	DISVY326	moderate	Biomarker	[34]
Colitis	DISAF7DD	moderate	Biomarker	[35]
Lung neoplasm	DISVARNB	moderate	Biomarker	[36]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[37]
Non-alcoholic fatty liver disease	DISDG1NL	Limited	Biomarker	[38]
Pulmonary emphysema	DIS5M7HZ	Limited	Genetic Variation	[39]
Renal fibrosis	DISMHI3I	Limited	Biomarker	[40]
Ulcerative colitis	DIS8K27O	Limited	Biomarker	[41]
------------------------------------------------------------------------------------


⏷ Show the Full List of 48 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of GA-binding protein alpha chain (GABPA).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of GA-binding protein alpha chain (GABPA).	[48]
------------------------------------------------------------------------------------

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of GA-binding protein alpha chain (GABPA).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of GA-binding protein alpha chain (GABPA).	[44]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of GA-binding protein alpha chain (GABPA).	[45]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of GA-binding protein alpha chain (GABPA).	[46]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of GA-binding protein alpha chain (GABPA).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of GA-binding protein alpha chain (GABPA).	[49]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of GA-binding protein alpha chain (GABPA).	[50]
GW7604	DMCA4RM	Investigative	GW7604 increases the expression of GA-binding protein alpha chain (GABPA).	[46]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol affects the localization of GA-binding protein alpha chain (GABPA).	[51]
------------------------------------------------------------------------------------

References

1	The discovery and characterization of K-563, a novel inhibitor of the Keap1/Nrf2 pathway produced by Streptomyces sp.Cancer Med. 2019 Mar;8(3):1157-1168. doi: 10.1002/cam4.1949. Epub 2019 Feb 8.
2	Nrf2 and SQSTM1/p62 jointly contribute to mesenchymal transition and invasion in glioblastoma.Oncogene. 2019 Dec;38(50):7473-7490. doi: 10.1038/s41388-019-0956-6. Epub 2019 Aug 23.
3	NF-E2-related factor 2 activation boosts antioxidant defenses and ameliorates inflammatory and amyloid properties in human Presenilin-1 mutated Alzheimer's disease astrocytes.Glia. 2020 Mar;68(3):589-599. doi: 10.1002/glia.23741. Epub 2019 Oct 31.
4	Nrf2 as a Potential Mediator of Cardiovascular Risk in Metabolic Diseases.Front Pharmacol. 2019 Apr 12;10:382. doi: 10.3389/fphar.2019.00382. eCollection 2019.
5	Emerging evidence for crosstalk between Nrf2 and mitochondria in physiological homeostasis and in heart disease.Arch Pharm Res. 2020 Mar;43(3):286-296. doi: 10.1007/s12272-019-01188-z. Epub 2019 Nov 11.
6	Association of Genetic Variations in NRF2, NQO1, HMOX1, and MT with Severity of Coronary Artery Disease and Related Risk Factors.Cardiovasc Toxicol. 2020 Apr;20(2):176-189. doi: 10.1007/s12012-019-09544-7.
7	Reactive Gliosis Contributes to Nrf2-Dependent Neuroprotection by Pretreatment with Dimethyl Fumarate or Korean Red Ginseng Against Hypoxic-Ischemia: Focus on Hippocampal Injury.Mol Neurobiol. 2020 Jan;57(1):105-117. doi: 10.1007/s12035-019-01760-0. Epub 2019 Sep 7.
8	Nuclear factor erythroid 2-related factor 2 as a treatment target of kidney diseases.Curr Opin Nephrol Hypertens. 2020 Jan;29(1):128-135. doi: 10.1097/MNH.0000000000000556.
9	PI3K/Akt-Nrf2 and Anti-Inflammation Effect of Macrolides in Chronic Obstructive Pulmonary Disease.Curr Drug Metab. 2019;20(4):301-304. doi: 10.2174/1389200220666190227224748.
10	Ethanol-Mediated Stress Promotes Autophagic Survival and Aggressiveness of Colon Cancer Cells via Activation of Nrf2/HO-1 Pathway.Cancers (Basel). 2019 Apr 10;11(4):505. doi: 10.3390/cancers11040505.
11	Ambient PM2.5 caused depressive-like responses through Nrf2/NLRP3 signaling pathway modulating inflammation.J Hazard Mater. 2019 May 5;369:180-190. doi: 10.1016/j.jhazmat.2019.02.026. Epub 2019 Feb 10.
12	Hesperetin ameliorates diabetic nephropathy in rats by activating Nrf2/ARE/glyoxalase 1 pathway.Biomed Pharmacother. 2019 Mar;111:1166-1175. doi: 10.1016/j.biopha.2019.01.030. Epub 2019 Jan 12.
13	Diabetic cardiomyopathy: molecular mechanisms, detrimental effects of conventional treatment, and beneficial effects of natural therapy.Heart Fail Rev. 2019 Mar;24(2):279-299. doi: 10.1007/s10741-018-9749-1.
14	Nrf2 induced cisplatin resistance in ovarian cancer by promoting CD99 expression.Biochem Biophys Res Commun. 2019 Oct 22;518(4):698-705. doi: 10.1016/j.bbrc.2019.08.113. Epub 2019 Aug 28.
15	Proteomic Analysis Reveals Novel Mechanisms by Which Polychlorinated Biphenyls Compromise the Liver Promoting Diet-Induced Steatohepatitis.J Proteome Res. 2019 Apr 5;18(4):1582-1594. doi: 10.1021/acs.jproteome.8b00886. Epub 2019 Mar 15.
16	SLC27A5 deficiency activates NRF2/TXNRD1 pathway by increased lipid peroxidation in HCC.Cell Death Differ. 2020 Mar;27(3):1086-1104. doi: 10.1038/s41418-019-0399-1. Epub 2019 Jul 31.
17	Gintonin, a ginseng-derived ingredient, as a novel therapeutic strategy for Huntington's disease: Activation of the Nrf2 pathway through lysophosphatidic acid receptors.Brain Behav Immun. 2019 Aug;80:146-162. doi: 10.1016/j.bbi.2019.03.001. Epub 2019 Mar 7.
18	LONP1 induction by SRT1720 attenuates mitochondrial dysfunction against high glucose induced neurotoxicity in PC12 cells.Toxicol In Vitro. 2020 Feb;62:104695. doi: 10.1016/j.tiv.2019.104695. Epub 2019 Oct 19.
19	Clinicopathological, microenvironmental and genetic determinants of molecular subtypes in KEAP1/NRF2-mutant lung cancer.Int J Cancer. 2019 Feb 15;144(4):788-801. doi: 10.1002/ijc.31975. Epub 2018 Dec 4.
20	Impacts of NRF2 activation in non-small-cell lung cancer cell lines on extracellular metabolites.Cancer Sci. 2020 Feb;111(2):667-678. doi: 10.1111/cas.14278. Epub 2020 Jan 15.
21	Different adaptive NO-dependent Mechanisms in Normal and Hypertensive Conditions.Molecules. 2019 Apr 30;24(9):1682. doi: 10.3390/molecules24091682.
22	Filtering through the role of NRF2 in kidney disease.Arch Pharm Res. 2020 Mar;43(3):361-369. doi: 10.1007/s12272-019-01177-2. Epub 2019 Aug 1.
23	Levo-corydalmine Attenuates Vincristine-Induced Neuropathic Pain in Mice by Upregulating the Nrf2/HO-1/CO Pathway to Inhibit Connexin 43 Expression.Neurotherapeutics. 2020 Jan;17(1):340-355. doi: 10.1007/s13311-019-00784-7.
24	Chlorpyrifos activates cell pyroptosis and increases susceptibility on oxidative stress-induced toxicity by miR-181/SIRT1/PGC-1/Nrf2 signaling pathway in human neuroblastoma SH-SY5Y cells: Implication for association between chlorpyrifos and Parkinson's disease. Environ Toxicol. 2019 Jun;34(6):699-707. doi: 10.1002/tox.22736. Epub 2019 Mar 5.
25	Carbon monoxide releasing molecule-A1 improves nonalcoholic steatohepatitis via Nrf2 activation mediated improvement in oxidative stress and mitochondrial function.Redox Biol. 2020 Jan;28:101314. doi: 10.1016/j.redox.2019.101314. Epub 2019 Aug 31.
26	Obesity-induced sympathoexcitation is associated with Nrf2 dysfunction in the rostral ventrolateral medulla.Am J Physiol Regul Integr Comp Physiol. 2020 Feb 1;318(2):R435-R444. doi: 10.1152/ajpregu.00206.2019. Epub 2019 Dec 11.
27	Alleviation of Cartilage Destruction by Sinapic Acid in Experimental Osteoarthritis.Biomed Res Int. 2019 Feb 26;2019:5689613. doi: 10.1155/2019/5689613. eCollection 2019.
28	Three novel genetic variants in NRF2 signaling pathway genes are associated with pancreatic cancer risk.Cancer Sci. 2019 Jun;110(6):2022-2032. doi: 10.1111/cas.14017. Epub 2019 May 6.
29	p62 as a therapeutic target for inhibition of autophagy in prostate cancer.Prostate. 2018 Apr;78(5):390-400. doi: 10.1002/pros.23483. Epub 2018 Jan 25.
30	Rapamycin attenuates the paraquat-induced pulmonary fibrosis through activating Nrf2 pathway.J Cell Physiol. 2020 Feb;235(2):1759-1768. doi: 10.1002/jcp.29094. Epub 2019 Jul 12.
31	Nrf2 activation in myeloid cells and endothelial cells differentially mitigates sickle cell disease pathology in mice.Blood Adv. 2019 Apr 23;3(8):1285-1297. doi: 10.1182/bloodadvances.2018017574.
32	Inhibition of Nrf2 promotes the antitumor effect of Pinelliae rhizome in papillary thyroid cancer.J Cell Physiol. 2019 Aug;234(8):13867-13877. doi: 10.1002/jcp.28069. Epub 2019 Jan 30.
33	Protective role of Nrf2 against ischemia reperfusion injury and cardiac allograft vasculopathy.Am J Transplant. 2020 May;20(5):1262-1271. doi: 10.1111/ajt.15724. Epub 2020 Jan 3.
34	Mitophagy Reduces Oxidative Stress Via Keap1 (Kelch-Like Epichlorohydrin-Associated Protein 1)/Nrf2 (Nuclear Factor-E2-Related Factor 2)/PHB2 (Prohibitin 2) Pathway After Subarachnoid Hemorrhage in Rats.Stroke. 2019 Apr;50(4):978-988. doi: 10.1161/STROKEAHA.118.021590.
35	FSGHF3 and peptides, prepared from fish skin gelatin, exert a protective effect on DSS-induced colitis via the Nrf2 pathway.Food Funct. 2020 Jan 29;11(1):414-423. doi: 10.1039/c9fo02165e.
36	Effects of KEAP1 Silencing on the Regulation of NRF2 Activity in Neuroendocrine Lung Tumors.Int J Mol Sci. 2019 May 23;20(10):2531. doi: 10.3390/ijms20102531.
37	Ginsenoside Rg1 protects mice against streptozotocin-induced type 1 diabetic by modulating the NLRP3 and Keap1/Nrf2/HO-1 pathways.Eur J Pharmacol. 2020 Jan 5;866:172801. doi: 10.1016/j.ejphar.2019.172801. Epub 2019 Nov 16.
38	Resveratrol alleviates non-alcoholic fatty liver disease through epigenetic modification of the Nrf2 signaling pathway.Int J Biochem Cell Biol. 2020 Feb;119:105667. doi: 10.1016/j.biocel.2019.105667. Epub 2019 Dec 12.
39	A Polymorphism rs6726395 in Nrf2 Contributes to the Development of Emphysema-Associated Age in Smokers Without COPD.Lung. 2019 Oct;197(5):559-564. doi: 10.1007/s00408-019-00251-2. Epub 2019 Jul 11.
40	Inhibition of p300/CBP-Associated Factor Attenuates Renal Tubulointerstitial Fibrosis through Modulation of NF-kB and Nrf2.Int J Mol Sci. 2019 Mar 28;20(7):1554. doi: 10.3390/ijms20071554.
41	Targeting Nrf2/HO-1 signaling by crocin: Role in attenuation of AA-induced ulcerative colitis in rats.Biomed Pharmacother. 2019 Feb;110:389-399. doi: 10.1016/j.biopha.2018.11.133. Epub 2018 Dec 5.
42	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
43	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
44	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
45	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
46	Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
47	Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
48	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
49	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
50	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
51	Involvement of p38 MAPK and Nrf2 in phenolic acid-induced P-form phenol sulfotransferase expression in human hepatoma HepG2 cells. Carcinogenesis. 2006 May;27(5):1008-17.